PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc10g055760.1.1
Common NameLOC101267943
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 284aa    MW: 32558 Da    PI: 7.2374
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc10g055760.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM152.12.5e-4751313128
                 NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                         pGfrFhPt+eel+ +yLk+k+ g++ ++ +vi  ++iy+++PwdLp   + +e+ewyfF+ rd+k+ +g r+nr+t++g+Wkatg+dk+++
  Solyc10g055760.1.1   5 PGFRFHPTEEELLEFYLKNKILGRTSRC-DVIGLLNIYRHDPWDLPGLSTIGEREWYFFVARDRKHGNGGRPNRTTEKGFWKATGSDKKII 94 
                         9************************999.99***************7667799*************************************9 PP

                 NAM  94 sk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                              ++ +glkktLvfy+grap+g+ktdWvm+e+rl
  Solyc10g055760.1.1  95 GLsnPKNIIGLKKTLVFYTGRAPRGSKTDWVMNEFRL 131
                         76446778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100553.3193149IPR003441NAC domain
SuperFamilySSF1019415.36E-564149IPR003441NAC domain
PfamPF023656.2E-265131IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0010200Biological Processresponse to chitin
GO:0045792Biological Processnegative regulation of cell size
GO:0048281Biological Processinflorescence morphogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MEDLPGFRFH PTEEELLEFY LKNKILGRTS RCDVIGLLNI YRHDPWDLPG LSTIGEREWY  60
FFVARDRKHG NGGRPNRTTE KGFWKATGSD KKIIGLSNPK NIIGLKKTLV FYTGRAPRGS  120
KTDWVMNEFR LPDTVSWPQD IVLCKIYRKA TSLKVLEQRA AIEEEMKHVH SSPCSTTLQT  180
MDAMSFGNEH HELTDKSPDL FTSISKDEVD DDRLSVAENK VSAETKEKSN CFRPKLLNGQ  240
DSLAELQVPK FSMDFSQDPV WMQLRSPWLD NFILTPSAFV HNF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-45514917168Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.56990.0callus| cell culture| fruit
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269|PubMed:26834774}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc10g055760.1.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269|PubMed:26834774}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0144030.0Lycopersicon esculentum clone 133708R, mRNA sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004248638.10.0NAC domain-containing protein 22
SwissprotQ10S651e-91NAC22_ORYSJ; NAC domain-containing protein 22
TrEMBLA0A3Q7IHY90.0A0A3Q7IHY9_SOLLC; Uncharacterized protein
STRINGSolyc10g055760.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35312248
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.11e-108NAC domain containing protein 36
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Hong Y,Zhang H,Huang L,Li D,Song F
    Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice.
    Front Plant Sci, 2016. 7: p. 4
    [PMID:26834774]