PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc10g050420.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ARR-B
Protein Properties Length: 417aa    MW: 47935.5 Da    PI: 9.3089
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc10g050420.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like61.81.3e-19204255355
             G2-like   3 rlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          l+Wt +LH++F++ +eqL G+ +  Pk+i+ +m+v+gLt+ +v+SHLQk R 
  Solyc10g050420.1.1 204 CLKWTANLHAKFMKSLEQL-GEGRCYPKEIVAVMDVPGLTRMQVASHLQKCRF 255
                         589****************.9*****************************995 PP

2Response_reg29.24.5e-11141171105
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         v++vd e ++   +  ++++ +y +v ++++++ea+e+l + +  +D+i++ +  p+++ ++ll +  + +  +  +++ ++ +e +a++a
  Solyc10g050420.1.1  14 VVLVDPETKNVTKMVDLMKSYDY-KVITVRTSSEAMEMLSKGEekIDVIIISVPTPNLNSFKLLDQAVTLD--IISLFICDEYNELLAKKA 101
                         689999*****************.9**************665556*******************9998877..888888899999****** PP

                         HHTTESEEEESS--HH CS
        Response_reg  90 lkaGakdflsKpfdpe 105
                         lk Ga+ f+  p ++e
  Solyc10g050420.1.1 102 LKEGASLFVHRPLNEE 117
                         ************7654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521721.17E-1211133IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23004.0E-1211149No hitNo description
PROSITE profilePS5011019.46913127IPR001789Signal transduction response regulator, receiver domain
PfamPF000723.2E-514117IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.38E-516122No hitNo description
SuperFamilySSF466893.4E-13200255IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.7E-19201256IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-15203255IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0005622Cellular Componentintracellular
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MATGYYGIVD EVRVVLVDPE TKNVTKMVDL MKSYDYKVIT VRTSSEAMEM LSKGEEKIDV  60
IIISVPTPNL NSFKLLDQAV TLDIISLFIC DEYNELLAKK ALKEGASLFV HRPLNEEIVK  120
YLWQFVLRRK IERETAKKGS EDGHKMTVND VDTNNMDGDN EVLSEKINYE EVEDHIGSNG  180
KYKRRRKNNR KDMKKNKVIK QKNCLKWTAN LHAKFMKSLE QLGEGRCYPK EIVAVMDVPG  240
LTRMQVASHL QKCRFNNWRS PEERKSNWRL SGQESSSESQ QKSSNRKYGT MPRFQNNIPN  300
QIQKGPEFPF STPNTSIGES STQEKLYPPQ CQVQPHYPNL DNSLNNPFLS VQNNVGCVLQ  360
QHKHRPVLEM FGSQRLRDPI IGNITHRPGS AFNCWNHHIQ SGSDSEYYVS KNNRLF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc10g050420.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2449480.0Solanum lycopersicum strain Heinz 1706 chromosome 10 clone sle-33k20 map 10, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025883438.10.0two-component response regulator ARR2-like
TrEMBLM1E1C80.0M1E1C8_SOLTU; Uncharacterized protein
STRINGSolyc10g050420.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8132384
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.15e-23response regulator 2
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]