PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc10g050210.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 389aa    MW: 42416.9 Da    PI: 10.5176
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc10g050210.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.65.5e-13310354549
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkel 49 
                         +r +r++kNRe+A rsR+RK+a++  Le +v++L++ N++L+k+ 
  Solyc10g050210.1.1 310 RRHKRMIKNRESAARSRARKQAYTFALEAEVAKLKEINEKLQKKQ 354
                         699**************************************9864 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.6E-11306371IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.852308353IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.13E-10310357No hitNo description
PfamPF001703.2E-11310357IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.6E-13310364No hitNo description
CDDcd147074.71E-23310364No hitNo description
PROSITE patternPS000360313328IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MGSGSFSLTR QSSMYSLTFE ELQSTCGFRK DVGSMNLEDL LKNISTAEES RGLASSAGVG  60
EGSMAAGTLQ RQGSLTLPRT LNQRTVDEVW RDFQNETTVS SNLGQKQSNL GEMTLEEFLV  120
RAGVVRDDNQ PNVTSNNVGF TGVLGEPSSN NNALNIAFQQ PTQSPGLLSK FSESNMLNVV  180
NVKSSQQQPQ QQQPLIPKKR NVDFASTMQL GNNCQLASPR ARAVVVSTSS RSVHATVVQG  240
GVMQNGVKGM AGLLSGVTFA PGGSPGNQLS SEMISKDKLY RSFLSPSPYA FNEGGRGRKS  300
CSTLEKVVER RHKRMIKNRE SAARSRARKQ AYTFALEAEV AKLKEINEKL QKKQAEFIDS  360
QKNQLLEKMN TSFGSKLRCL RRTLTGPW*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc10g050210.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2440630.0Solanum lycopersicum strain Heinz 1706 chromosome 10 clone hba-5f7 map 10, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015089552.10.0ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform X1
TrEMBLA0A3Q7IH050.0A0A3Q7IH05_SOLLC; Uncharacterized protein
STRINGSolyc10g050210.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7762497
Representative plantOGRP39841024
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G45249.13e-81abscisic acid responsive elements-binding factor 2
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]