PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc10g019150.1.1
Common NameLOC104644286
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB_related
Protein Properties Length: 165aa    MW: 18552.1 Da    PI: 9.8254
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc10g019150.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.94.6e-1356101247
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         ++WT++E+  ++++   +G+g+W++Ia+ +   Rt  q+ s+ qky
  Solyc10g019150.1.1  56 NPWTEDEQIAFLKGLDFHGKGSWSKIAKDFVPSRTSTQVASHAQKY 101
                         69*****************************9*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.13650106IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-1152103IPR009057Homeodomain-like
SuperFamilySSF466897.03E-1453105IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-1353104IPR006447Myb domain, plants
SMARTSM007177.7E-1054104IPR001005SANT/Myb domain
PfamPF002493.9E-1156101IPR001005SANT/Myb domain
CDDcd001672.64E-1057102No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MERNCTVCGG NGHNQRTCSE KGKSIKLFGV EITTASSAGG AMSKKDSMER RIKRGNPWTE  60
DEQIAFLKGL DFHGKGSWSK IAKDFVPSRT STQVASHAQK YFMRLLDANE RKYHKKSSVF  120
DLRLDQLEDT HDHAIVPLGN NYESQNVPSV IPNYYMMKRV LPLN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc10g019150.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2424880.0Solanum lycopersicum strain Heinz 1706 chromosome 10 clone hba-72f2 map 10, complete sequence
GenBankAC2424940.0Solanum lycopersicum strain Heinz 1706 chromosome 10 clone slm-40l2 map 10, complete sequence
GenBankAC2428280.0Solanum lycopersicum strain Heinz 1706 clone sle-21d10 map 10, complete sequence
GenBankAC2453730.0Solanum lycopersicum strain Heinz 1706 chromosome 10 clone sle-58c22 map 10, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015054810.11e-119transcription factor MYBS3-like
TrEMBLA0A3Q7IDB21e-122A0A3Q7IDB2_SOLLC; Uncharacterized protein
STRINGSolyc10g019150.1.11e-122(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74541230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.14e-28MYB_related family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]