PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc10g009360.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Dof
Protein Properties Length: 262aa    MW: 28540.7 Da    PI: 9.4411
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc10g009360.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.61.3e-382786261
              zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                        k++ ++cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rkn++ 
  Solyc10g009360.2.1 27 KDQVVNCPRCNSTNTKFCYYNNYSLTQPRYFCKTCRRYWTEGGTLRNVPVGGGSRKNRRC 86
                        78999****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-292085IPR003851Zinc finger, Dof-type
PfamPF027019.8E-332885IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.913185IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103369IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MATQIAPPNV TCSRTSTTME KKVRPQKDQV VNCPRCNSTN TKFCYYNNYS LTQPRYFCKT  60
CRRYWTEGGT LRNVPVGGGS RKNRRCSISS SSLSSISSSQ KLLDLNPNPS LSSLQNPNYN  120
LNLGSNQDLN LGFPSFNIHN HNNYFRGMPQ FLDFPKMDKG NNGINHFSTS TSNTSPVSAL  180
DLLQKGIASR GLTASISSSS SPSTPDLNAL YTSSEVQENG AKMMLPFGCL NNHNNSESKG  240
QENSSSVGFW NDGMLGGGGT W*
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Turned off in siliques when they reached full maturation. Not expressed in developing or mature embryos.
UniprotDEVELOPMENTAL STAGE: Turned off in siliques when they reached full maturation. Not expressed in developing or mature embryos.
UniprotTISSUE SPECIFICITY: Expressed in the phloem of the mother plant, including in roots, stem, leaves and flowers, but not present in the seed and embryo. In maturing siliques, found all through the funiculus connecting the placenta to the ovule, but not in the ovule.
UniprotTISSUE SPECIFICITY: Expressed in the vascular system of the mother plant, but not present in the seed and embryo. In maturing siliques, found all through the funiculus connecting the placenta to the ovule, but not in the ovule.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor specifically involved in the maternal control of seed germination. Regulates transcription by binding to a 5'-AA[AG]G-3' consensus core sequence. May ensure the activation of a component that would trigger germination as a consequence of red light perception.
UniProtTranscription factor specifically involved in the maternal control of seed germination. Regulates transcription by binding to a 5'-AA[AG]G-3' consensus core sequence. May ensure the inactivity of a component that would be activated to trigger germination as a consequence of red light perception.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc10g009360.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2331203e-44Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-101i8 map 1, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004248087.10.0dof zinc finger protein DOF2.5-like isoform X1
SwissprotQ433856e-42DOF37_ARATH; Dof zinc finger protein DOF3.7
SwissprotQ9ZPY01e-41DOF25_ARATH; Dof zinc finger protein DOF2.5
TrEMBLA0A3Q7J7A80.0A0A3Q7J7A8_SOLLC; Uncharacterized protein
STRINGSolyc10g009360.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.45e-42Dof family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]