PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc10g005080.2.1
Common NameLOC101261662
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB_related
Protein Properties Length: 763aa    MW: 83707.9 Da    PI: 6.4
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc10g005080.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.54.6e-162468147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        r rWT+eE+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
  Solyc10g005080.2.1 24 RERWTEEEHNRFLEALKLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 68
                        78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.22E-171874IPR009057Homeodomain-like
PROSITE profilePS5129420.1731973IPR017930Myb domain
TIGRFAMsTIGR015577.0E-172271IPR006447Myb domain, plants
SMARTSM007171.1E-122371IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-82464IPR009057Homeodomain-like
PfamPF002493.2E-132467IPR001005SANT/Myb domain
CDDcd001671.48E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010243Biological Processresponse to organonitrogen compound
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043496Biological Processregulation of protein homodimerization activity
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 763 aa     Download sequence    Send to blast
MDPYSSGEEL VVKTRKPYTI TKQRERWTEE EHNRFLEALK LYGRAWQRIE EHIGTKTAVQ  60
IRSHAQKFFT KLEKEALTKG VPTSQALDIE IPPPRPKRKP SNPYPRKTSA AGHSSQVGAK  120
DGKYSTTFSS ICEERNLFDL EKEPITEKPG GNEKLGNVKE TQNKKNCSQG LTKEGASAAS  180
MSSGKSLQAH VAPTDVCAFS ESVSVTKGVV NNDNANKSFL IVESKEHQQS EILDIRQSFQ  240
GNSSCNTFDG GKSCQSSEKL AQGEKKHPSF QPNHLGEFSR NDMQVLHNYP RHVPVHILDG  300
TNGSQIAPDM FNHESTSQQI NGVPGLPNLY SNPASSTTSE HHSNAPQSSI HQSFSCFHPI  360
FTPIRDPDDY RSFFQLSSTF SSLIVSALLQ NPAAHVAASF AASFWPYANM ERPTDSPTDN  420
TASQINSAPS MAAIAAATVA AATAWWAAHG LLPLCSQFQS SFTCVPTSAT SMQVDACQPR  480
VDKNEGREGT HDSPHVQEPV PECSEALQEQ QSGSKLPPSL SSESEESEGR KLKTGLTATD  540
TEQGAAVTKI NEPNAEKGGK QVDRSSCGSN TPSSSEIETD ALEKDEKGKE EPQESNINLL  600
AGEAANRRYR NFISPTESWK EVSEEGRIAF QALFTREVLP QSFSPSLDLK NKGKIILEKL  660
KQKPDEKVQC GPQLDLNDMA SNICSSHQTM EDNVLLIGNK EDVETCLPMI ELGQVRLKAR  720
RTGFKPYKRC SLEANDSRVT SSNCQDEEKS SKRLRLEGEA ST*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.49230.0flower| fruit| leaf| root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00103PBMTransfer from AT2G46830Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc10g005080.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0129120.0Lycopersicon esculentum clone 114030R, mRNA sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004248416.10.0protein LHY isoform X2
RefseqXP_010327245.10.0protein LHY isoform X2
RefseqXP_019071645.10.0protein LHY isoform X2
RefseqXP_025883775.10.0protein LHY isoform X2
TrEMBLA0A3Q7IAI70.0A0A3Q7IAI7_SOLLC; Uncharacterized protein
STRINGSolyc10g005080.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA97101315
Representative plantOGRP9903510
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.32e-49MYB_related family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]