PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc10g005010.2.1
Common NameLOC101263643
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 288aa    MW: 33538.4 Da    PI: 6.8571
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc10g005010.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.81.7e-52151431128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                         +ppGfrFhPt+eel+++yLkkkv+++k++l +vi+evd++k+ePwd++ k+k     +++wyfFs++dkky+tg+r+nrat++g+Wkatg+
  Solyc10g005010.2.1  15 VPPGFRFHPTEEELLQYYLKKKVANEKIDL-DVIQEVDLNKLEPWDIQDKCKIgstPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGR 104
                         69****************************.9***************954444122455******************************** PP

                 NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         dk ++s + + +g++ktLvfykgrap+g+k+dW+mheyr+
  Solyc10g005010.2.1 105 DKVIYS-NCRRIGMRKTLVFYKGRAPHGQKSDWIMHEYRF 143
                         ******.8889***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.93E-5910161IPR003441NAC domain
PROSITE profilePS5100556.59615161IPR003441NAC domain
PfamPF023654.9E-2816142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0010047Biological Processfruit dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MPEEMSISVN GQSQVPPGFR FHPTEEELLQ YYLKKKVANE KIDLDVIQEV DLNKLEPWDI  60
QDKCKIGSTP QNDWYFFSHK DKKYPTGTRT NRATAAGFWK ATGRDKVIYS NCRRIGMRKT  120
LVFYKGRAPH GQKSDWIMHE YRFDDHIAEE EGWVICRIFK KKNHHVNVKS FDTHHHHSPY  180
PPNNHIDEEG PLEQLLHYMT RCKEENHNMQ LPNLDTHPNS CEGGLNNWIA VDRLVASHLN  240
GQTINDNYEH HQYIVNTTNH EDYLWSFPTL SSTNNDSLCH VSNGIIS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-501216314167NO APICAL MERISTEM PROTEIN
1ut4_B7e-501216314167NO APICAL MERISTEM PROTEIN
1ut7_A7e-501216314167NO APICAL MERISTEM PROTEIN
1ut7_B7e-501216314167NO APICAL MERISTEM PROTEIN
3ulx_A7e-5091649171Stress-induced transcription factor NAC1
4dul_A7e-501216314167NAC domain-containing protein 19
4dul_B7e-501216314167NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.232720.0fruit| root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in various aboveground tissues undergoing thickening of the lignified secondary wall such as anthers, filaments of stamens, the base of carpels, styles, the boundaries between siliques and pedicels, the midrib of leaf veins, and inflorescence stems, specifically in interfascicular fibers (sclerenchyma), cells differentiating into vascular vessels, and xylary fibers (secondary xylem). {ECO:0000269|PubMed:16214898, ECO:0000269|PubMed:17237351}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator of genes involved in biosynthesis of secondary walls. Together with NST2 and NST3, required for the secondary cell wall thickening of sclerenchymatous fibers, secondary xylem (tracheary elements), and of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues. {ECO:0000269|PubMed:16214898, ECO:0000269|PubMed:17237351, ECO:0000269|PubMed:17333250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00321DAPTransfer from AT2G46770Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc10g005010.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2179163e-17Solanum lycopersicum LeftsH6 mRNA for FtsH protease, complete cds
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004248423.10.0NAC domain-containing protein 43
SwissprotQ84WP61e-112NAC43_ARATH; NAC domain-containing protein 43
TrEMBLA0A3Q7J5280.0A0A3Q7J528_SOLLC; Uncharacterized protein
STRINGSolyc10g005010.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-102NAC family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  3. Gondolf VM, et al.
    A gene stacking approach leads to engineered plants with highly increased galactan levels in Arabidopsis.
    BMC Plant Biol., 2014. 14: p. 344
    [PMID:25492673]
  4. Jaradat MR,Ruegger M,Bowling A,Butler H,Cutler AJ
    A comprehensive transcriptome analysis of silique development and dehiscence in Arabidopsis and Brassica integrating genotypic, interspecies and developmental comparisons.
    GM Crops Food, 2014. 5(4): p. 302-20
    [PMID:25523176]
  5. Yuan Y,Teng Q,Zhong R,Ye ZH
    TBL3 and TBL31, Two Arabidopsis DUF231 Domain Proteins, are Required for 3-O-Monoacetylation of Xylan.
    Plant Cell Physiol., 2016. 57(1): p. 35-45
    [PMID:26556650]
  6. Yang C, et al.
    Transcription Factor MYB26 Is Key to Spatial Specificity in Anther Secondary Thickening Formation.
    Plant Physiol., 2017. 175(1): p. 333-350
    [PMID:28724622]
  7. Pascual MB, et al.
    PpNAC1, a main regulator of phenylalanine biosynthesis and utilization in maritime pine.
    Plant Biotechnol. J., 2018. 16(5): p. 1094-1104
    [PMID:29055073]
  8. Liu C,Yu H,Li L
    SUMO modification of LBD30 by SIZ1 regulates secondary cell wall formation in Arabidopsis thaliana.
    PLoS Genet., 2019. 15(1): p. e1007928
    [PMID:30657769]