PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc09g089550.2.1
Common NameLOC101258410
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ZF-HD
Protein Properties Length: 806aa    MW: 90496.5 Da    PI: 7.3636
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc09g089550.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.13.7e-32554608358
         ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                         ++rY+eClkNhAas+Ggha+DGCgEfmps geegt+ alkCaAC+CH nFHR+e +
  Solyc09g089550.2.1 554 SIRYRECLKNHAASMGGHALDGCGEFMPS-GEEGTPGALKCAACNCHQNFHRKEID 608
                         789*************************9.999********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF141111.3E-842124IPR025558Domain of unknown function DUF4283
PfamPF141111.4E-10308392IPR025558Domain of unknown function DUF4283
PfamPF047707.0E-30555607IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257742.0E-22556608IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015668.0E-30556607IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.735557606IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 806 aa     Download sequence    Send to blast
MAAPQRDFNI ENQEEPKSKI VYLNYRRVPA VIFRKKYWDW NSMVAVCKLT MVGKFFIPKP  60
KMTKIRASFH AKLSLKGVVK IRSYDSYHVF IDFTAEEDYQ SVLLKERVVV AGAIMEVFQW  120
TPEFHDQFRE AFGVVELENT KKDEHIGGGN EYGTEESDSV ACVPEVTHSD SEDRVASPIK  180
CETSKLPSSV GISCSEFSGL SSAPYRITGR IPSVTYESSS MCSTELVPFR GTYLNHNNLK  240
SYSREWNYGS KPTSEAADLA CETLSQPLYA LSIVERHENQ KSRPPIEVQH STYMGYPTLT  300
FPRRYGESLV SDYKLTLLGN FSYKRPKMKE IRADFKAQNP LSGQVKIRNC SSRQVLILFS  360
NEEDYYTVLY KKAIIVAGAL MQISWSSPDF HHEVKQNIHP DFRLSDAKSV NWNTDTSKLH  420
PSINGLLAPA TDEKSMSLQV PAVSQCLSVP SICPPLPLLA HSVSVAGRLC ADRLTTSGIY  480
VPQSYPKGIV GIPIFGSNEQ AGSGNTFPRP SQALNQQSLA QQHNQLNSYK PNMTVRIAQL  540
QPPSTTSVSD ITSSIRYREC LKNHAASMGG HALDGCGEFM PSGEEGTPGA LKCAACNCHQ  600
NFHRKEIDDY QPMDDVGSHS RFSQPRNNSS SGSIQNQVLI SLPTQQYHHD YSDSCSPRSL  660
VDSLQPYTQP PSPTSGSVYS QQALERIQPS SIRSSYSYEM VNHNTMQNGK QREYFWSDSS  720
RNTSRDHPSV RNENWNFDMD KPLNNRTPDH IPLEFPTYPS RCQPQTVFTD EFPHLDIINN  780
LLHEEHETGR TLMSNSGSQR LNKGS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.93421e-101fruit
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc09g089550.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004247917.10.0uncharacterized protein LOC101258410 isoform X2
TrEMBLA0A3Q7I7630.0A0A3Q7I763_SOLLC; Uncharacterized protein
STRINGSolyc09g089550.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14101810
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75240.15e-25homeobox protein 33
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]