PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc09g057880.2.1
Common NameLOC101266066
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family FAR1
Protein Properties Length: 262aa    MW: 29680.6 Da    PI: 7.2372
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc09g057880.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR182.38.1e-2695185191
                FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                         +fY+ YA++vGF +r+++ ++s+ +++  +r++ C+k+g+  + k+++   r+ r++tr gCka+l vk +k++kw+vt++++eH+H+l+p
  Solyc09g057880.2.1  95 EFYDYYARRVGFIMRIDQCRRSEVDKRSLSRRLSCNKQGHYVKMKNHHGPPRKARTSTREGCKAMLLVKVNKSDKWVVTRFVKEHTHQLVP 185
                         6**********************************************9*****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.0E-2395185IPR004330FAR1 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009585Biological Processred, far-red light phototransduction
GO:0010018Biological Processfar-red light signaling pathway
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MFEEEEPDLG EETSEIRIKA STALNPQNLV PSGTSKAASA VHTSDTHHFG VAVDLKAGVT  60
TIDCSAESQS VVCQDNVVPE PFIGMEFESE YAAKEFYDYY ARRVGFIMRI DQCRRSEVDK  120
RSLSRRLSCN KQGHYVKMKN HHGPPRKART STREGCKAML LVKVNKSDKW VVTRFVKEHT  180
HQLVPSGCSS GNAMDKKDRR IQELSMELEH QDKLCDLYRE QLVTFLENVE QQMELMSKKI  240
QVAVNNVKEV EAEVQKQPNS K*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.151910.0callus| fruit| leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc09g057880.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010326278.10.0protein FAR1-RELATED SEQUENCE 2 isoform X1
RefseqXP_025888596.10.0protein FAR1-RELATED SEQUENCE 2 isoform X1
RefseqXP_025888597.10.0protein FAR1-RELATED SEQUENCE 2 isoform X1
TrEMBLA0A3Q7I1N90.0A0A3Q7I1N9_SOLLC; Uncharacterized protein
STRINGSolyc09g057880.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA116022025
Representative plantOGRP3376727
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43280.12e-57FAR1 family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]