PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc09g057870.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family FAR1
Protein Properties Length: 170aa    MW: 19108.8 Da    PI: 9.208
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc09g057870.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR185.96.2e-2762148290
                FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                         +Y++YA+++GF +r+++ ++s rnge ++r++vC+keg++++++++  + +++    r gCka++ vkke++gkw v+kl++eHnHel+
  Solyc09g057870.2.1  62 YYSTYATHLGFIMRVDAFRRSMRNGELVWRRLVCNKEGFSKSRQSQ--NGKKKCRAIREGCKAMIIVKKEQSGKWLVAKLVKEHNHELV 148
                         8*****************************************9988..888888899******************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.2E-2562148IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MVQTSSPKEF TTNQDNATDD VGIVETSTEK EFTPNGLEVE GRSNMEPYVG MEFESEEAAK  60
AYYSTYATHL GFIMRVDAFR RSMRNGELVW RRLVCNKEGF SKSRQSQNGK KKCRAIREGC  120
KAMIIVKKEQ SGKWLVAKLV KEHNHELVVK PVNTPKGAIL CQTPVIQGF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.6150.0fruit| leaf| trichome
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in hypocotyls, rosette and cauline leaves, inflorescences stems, flowers and siliques. {ECO:0000269|PubMed:15591448}.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription activator involved in regulating light control of development.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc09g057870.2.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in hypocotyls by far-red light treatment. {ECO:0000269|PubMed:15591448}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010326272.11e-122protein FAR1-RELATED SEQUENCE 1 isoform X2
RefseqXP_015086379.11e-122protein FAR1-RELATED SEQUENCE 1 isoform X5
RefseqXP_015086380.11e-122protein FAR1-RELATED SEQUENCE 1 isoform X6
SwissprotQ9SZL82e-24FRS5_ARATH; Protein FAR1-RELATED SEQUENCE 5
TrEMBLA0A3Q7I4451e-114A0A3Q7I445_SOLLC; Uncharacterized protein
STRINGSolyc09g057870.2.11e-125(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA127911520
Representative plantOGRP3376727
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07500.12e-50FAR1 family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Joly-Lopez Z, et al.
    Abiotic Stress Phenotypes Are Associated with Conserved Genes Derived from Transposable Elements.
    Front Plant Sci, 2017. 8: p. 2027
    [PMID:29250089]