PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc09g010680.2.1
Common NameLOC101255126
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Dof
Protein Properties Length: 399aa    MW: 42445.5 Da    PI: 9.5238
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc09g010680.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1208.4e-3882141362
              zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                         e+alkcprCdstntkfCy+nnyslsqPr+fCkaC+ryWt+GGalr vPvGgg+r+nk+s+
  Solyc09g010680.2.1  82 ETALKCPRCDSTNTKFCYFNNYSLSQPRHFCKACKRYWTRGGALRSVPVGGGCRRNKRSN 141
                         6789*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-3465134IPR003851Zinc finger, Dof-type
PfamPF027011.9E-3284139IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.24585139IPR003851Zinc finger, Dof-type
PROSITE patternPS01361087123IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MNFSSIPAYL DPANWQQQSG STIQNHHHHQ QQQLTSAPPP PVLPPGPPVV APLQPHGGGG  60
AGSIRPGSMA DRARMANITM PETALKCPRC DSTNTKFCYF NNYSLSQPRH FCKACKRYWT  120
RGGALRSVPV GGGCRRNKRS NNNNKNSTNN NNNNNSSKSP ASSTSTDGRQ GTNNSGSSTT  180
ISSHSNSFSG PTSAASLLGL MSPQIPPLRF MSPLGQFSSD HHHHHHFTPS NHMNLNFSTS  240
SCGNILGGTT EGMMVSNNNL LGTGTGAGVG GHVASLLSSG NLEHWRMQQQ FPNFLGGFDP  300
SNSPSSYPFQ GGVHEAVQYL GGESTSQISR PKISTSMLNQ MASVKMEDNN NNNSNQDQSA  360
LSRQLLGIQG NNENWNTSAS AWSDLSASFS SSSTSNAL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.246040.0fruit
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc09g010680.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004246430.10.0dof zinc finger protein DOF2.4
TrEMBLA0A3Q7HZW10.0A0A3Q7HZW1_SOLLC; Uncharacterized protein
STRINGSolyc09g010680.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA19172463
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02460.12e-43Dof family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]