PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc09g009760.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 500aa    MW: 55634.4 Da    PI: 6.3317
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc09g009760.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1262e-08173235163
                         XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         eke +r  r   NRe+Ar   +R++a  eeL++k++ L++eN  Lk + e   ke+++lk+e+
  Solyc09g009760.1.1 173 EKEERRLSRVLANRESARQTIRRRQAMYEELTRKAADLSSENNNLKTKKELAAKEYDYLKNEN 235
                         577778888888************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.0E-5167233No hitNo description
SMARTSM003384.0E-9173237IPR004827Basic-leucine zipper domain
PfamPF001707.1E-7173235IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.944175238IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.16E-5177233No hitNo description
CDDcd147021.53E-12178229No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 500 aa     Download sequence    Send to blast
MKDKFTPPCK AEEGKFAGGD EKGELVDFEM EAAQALACLA NPGSRSDEFS VPGPSGRSEA  60
LVICKFVYFM MIIELISHMV VFRGGCTSRA TGSAEFSNSA PDPVQVLMCF GRWKHLFKAL  120
MNREVQTQTL QFHEHVITIQ SEHESEPKTS PRHVLNYPPV ASRRSRQNMT EEEKEERRLS  180
RVLANRESAR QTIRRRQAMY EELTRKAADL SSENNNLKTK KELAAKEYDY LKNENVTLRR  240
QMSRIEKAEA EETDGASRSK PVEISTTSPT PAPNPTPTPA PTSLFNQPPI LPFFWPSIVQ  300
PFNLLQCSTQ NISDIASVVP SPIAGEFNSI NRQQISNPGN PLYLLPLPCL IPFYPQSNPF  360
LPWASTVTEK HAETSSANQC STSYMNMENN QAATTQETET EAFLGFPPDS CASDRRRQLS  420
REMIPTTGPS GYIDTHHQQE DDAPDTNALS CTAGHRGDTS EKTSEEPITC SSEKTADAIA  480
AATEARKRRK ELLHLKGHH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1485490RKRRKE
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc09g009760.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027775322.10.0LOW QUALITY PROTEIN: uncharacterized protein DDB_G0284459
TrEMBLK4CR050.0K4CR05_SOLLC; Uncharacterized protein
STRINGSolyc09g009760.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA54171724
Representative plantOGRP45691318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.17e-21bZIP family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]