PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc09g009200.1.1
Common NameLOC101268132
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRF
Protein Properties Length: 382aa    MW: 42036.9 Da    PI: 9.2625
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc09g009200.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC79.92.3e-25149192144
                 WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                         d+epgrCrRtDGKkWRCsr+v++g+k+CErH+hrgr+rsrk++e
  Solyc09g009200.1.1 149 DPEPGRCRRTDGKKWRCSRDVVSGHKYCERHVHRGRNRSRKPVE 192
                         79***************************************987 PP

2QLQ50.94.8e-1880114236
                 QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36 
                         +F+ aQ+q+L+ Q+l+yK+++a++PvP+eLl  i+
  Solyc09g009200.1.1  80 YFSLAQWQELELQALIYKHMLAGAPVPHELLYLIK 114
                         7*****************************98887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009518.5E-1079115IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166619.68480115IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.7E-1380113IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.911149193IPR014977WRC domain
PfamPF088793.0E-21150192IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MDFKLKQWRN ESSSSEEKST KLPNLVLDLD SFSPSCYSHS DSDSNSSALP LFVSEPINKL  60
SAFADSSLTP TKLPSMGNGY FSLAQWQELE LQALIYKHML AGAPVPHELL YLIKKSLSNS  120
SPYYNMSQQY HHYQQAMLHS GYWGRTNMDP EPGRCRRTDG KKWRCSRDVV SGHKYCERHV  180
HRGRNRSRKP VEIPTTTTPR GCNAATSSRG GSEVRKVNPA MTSHGGVTPQ FALSGHANSV  240
DLLHLNQRPS KSIIEKKVPM EAQNDSKPSG QILRHFFDDW PRQQLEENEN ATSMASATSL  300
SISMPGNSSS DVSLKLSTGD RHNSGTGVHN VERSMWGSTQ VAPMGGPLAE ALRSSMSSSS  360
PTSVLHHLPR GSTSEASYVT T*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc09g009200.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004246560.10.0growth-regulating factor 3-like
TrEMBLA0A3Q7HWU00.0A0A3Q7HWU0_SOLLC; Uncharacterized protein
STRINGSolyc09g009200.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32832138
Representative plantOGRP9959611
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52910.18e-65growth-regulating factor 4
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]