PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc09g008100.2.1
Common NameLOC101265471
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB_related
Protein Properties Length: 818aa    MW: 90040.9 Da    PI: 6.7456
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc09g008100.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.23.9e-0885127347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT +E+e +  a +q G++ +++I ++++  +   q++++++ +
  Solyc09g008100.2.1  85 AWTRQEEESFFSALRQVGKN-FEKITSRVQ-SKNKDQVRHYYYRL 127
                         6*****************99.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129313.41381132IPR017884SANT domain
SuperFamilySSF466895.31E-1081132IPR009057Homeodomain-like
SMARTSM007173.2E-682130IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-584130IPR009057Homeodomain-like
CDDcd001678.93E-685128No hitNo description
PfamPF002493.3E-685127IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003682Molecular Functionchromatin binding
Sequence ? help Back to Top
Protein Sequence    Length: 818 aa     Download sequence    Send to blast
MQMVQQVSLE RDTCLHPETF MGKDGLSGVT QHPAVALSVI PSNDHLASQQ SVLTHDHAVT  60
QLVPSSQDHV MLQLPAKRQP RQWAAWTRQE EESFFSALRQ VGKNFEKITS RVQSKNKDQV  120
RHYYYRLVRR MNKLLGPELC LDAKNSKDTN AAMLRWWSLL EKYSCKASKL HLKPRRFKIF  180
IETLESQLLK DRKKNVRRRP SQGESSSTAA GSPSSHGRVS TNDSRTVKVV LLDNQDVQKF  240
GSGKGSSIKR HVMGVNRSNA KVDSSVKNAR HRRRTGSAST AAYKRWEKAA IAGVSLVADA  300
AEHLERATID KDVGLVQNSQ AINGFEHVGK NVHSLPTLSQ NLLNETNLQS CMKLKLQLFP  360
VDEGTRRSLE MDNHNPYLEL TLSNRKKMSS VLEHLNRKWG SSSIATGELV LFPYHVQMEN  420
LVQSLRWTKD TTQSAADVHN LIGSPPVFRL RYGWFPNAEL GTPLELLSSA IPFMQNINPN  480
ITNENNAEIL ASSPGKLVRF SKEPLASNPR MTVTSSSIKL SGESNLQASM GLNTYTYDHD  540
GTLPLNRREN GDATTAEQAE MHDMQGSKAS ALSAGDWEDS LTNISVGDLL FDAPDDEETD  600
CIDSALCGSS HFLSQMPLSC DSFDAAIAAH IYKHQSKADS QMALPPQASS IWNAEDTCDA  660
FAFKKNVAFS DKSQCSSSNV GAENSQRIAQ SSSLVLDAVI KDLPGNMESF NGEPAHDDAV  720
DECQSDAQAL DGSSKDLNGL SGIYWTDSLG PLELDAPSCR YHSEDITLSD SLGGFNRLIV  780
NSLDAFQNCS FFGLDKTEPG STVEPVKTSD LKIGAEV*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.126330.0fruit| leaf| trichome
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in flowers, roots and leaves. {ECO:0000269|PubMed:15047893}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc09g008100.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF6476040.0Solanum lycopersicum chromosome 9 clone C09HBa0116C14, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025888547.10.0TSL-kinase interacting protein 1 isoform X3
SwissprotQ8LJT80.0TKI1_ARATH; TSL-kinase interacting protein 1
TrEMBLA0A3Q7HWQ20.0A0A3Q7HWQ2_SOLLC; Uncharacterized protein
STRINGSolyc09g008100.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA86401719
Representative plantOGRP21641015
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36960.20.0TSL-kinase interacting protein 1
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]