PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc09g007570.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB_related
Protein Properties Length: 257aa    MW: 28668.4 Da    PI: 4.7314
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc09g007570.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.11.5e-1159103347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE+  ++++   +G g+W++I+r+   +Rt+ q+ s+ qk+
  Solyc09g007570.1.1  59 PWTEEEHRSFLRGLDIYGRGDWRSISRHCVITRTGMQVASHAQKF 103
                         8***************************9989***********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512935.574125IPR017884SANT domain
PROSITE profilePS5129417.34752108IPR017930Myb domain
SuperFamilySSF466893.8E-1555108IPR009057Homeodomain-like
SMARTSM007171.2E-956106IPR001005SANT/Myb domain
TIGRFAMsTIGR015573.1E-1457106IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.607.7E-1058100IPR009057Homeodomain-like
CDDcd001672.75E-959104No hitNo description
PfamPF002492.1E-959102IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MEEALPQKSL QDIKDHYNIL LEDINAIDSG CVPLLNYLEM QSNANQNLKA DAKWRRGTPW  60
TEEEHRSFLR GLDIYGRGDW RSISRHCVIT RTGMQVASHA QKFFKRLEAA NKGERRASIL  120
DITSADAEAA GTSQVPKTED MIGPACGGSQ VVPNMSPQES TNAEQQMTTV AEDIDDLMTE  180
LEDATAASSG TYSHAITRIG SELEALLAEE QDYVYLQRLI LVEFFNKKTL AIRVLACSLF  240
ISVFLWLPDH KTYLVL*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young seedlings, developing leaves, sepals and trichomes. {ECO:0000269|PubMed:26243618}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc09g007570.1.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004246920.21e-155transcription factor SRM1-like
SwissprotQ9FNN61e-38SRM1_ARATH; Transcription factor SRM1
TrEMBLA0A3Q7ISF01e-147A0A3Q7ISF0_SOLLC; Uncharacterized protein
STRINGSolyc09g007570.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA44541329
Representative plantOGRP1230136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.15e-41MYB family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Wang T, et al.
    Salt-Related MYB1 Coordinates Abscisic Acid Biosynthesis and Signaling during Salt Stress in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1027-41
    [PMID:26243618]
  3. Chen YS, et al.
    Two MYB-related transcription factors play opposite roles in sugar signaling in Arabidopsis.
    Plant Mol. Biol., 2017. 93(3): p. 299-311
    [PMID:27866313]