PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc09g005560.2.1
Common NameLOC101249201
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Trihelix
Protein Properties Length: 294aa    MW: 34425.9 Da    PI: 7.6943
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc09g005560.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix80.62.3e-2545127186
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                         +W+ qe+++ + +r e+++++ ++k++k lWe ++ km+e+g++rsp+qCk+kw+nl +ryk +++ e +     ++++p++++l+
  Solyc09g005560.2.1  45 QWSIQETRDFLMIRAELDQTFMETKRNKLLWEVIATKMKEKGYNRSPEQCKCKWKNLVTRYKGCETVEPEA--L-RQQFPFYNELQ 127
                         7********************************************************************95..3.4589*****98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122034.02E-2344109No hitNo description
PfamPF138377.8E-2145129No hitNo description
PROSITE profilePS500907.44546102IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0016592Cellular Componentmediator complex
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MDPHLHHHQH HLQQQQHQFS HQSVNIDTTS GGVNIGGGGG DRFPQWSIQE TRDFLMIRAE  60
LDQTFMETKR NKLLWEVIAT KMKEKGYNRS PEQCKCKWKN LVTRYKGCET VEPEALRQQF  120
PFYNELQAIF GARMQRMLWI EAEGGVGGGA SGSKKKAISS DEEEENDDSD GEKVGKKKRK  180
VKGSMMVGSS SGNNNNNNLV SSLKEILDDF MKQQMVMEMQ WLKAYEAKEE ERRIKEMEWR  240
QTMEALENER LMMETRWRER EEQRRMREEA RAEKRDALIT TLLNKLRRED HNM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A2e-1342106367DNA binding protein GT-1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1175180KKKRKV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004246753.10.0PREDICTED: trihelix transcription factor GT-3b
SwissprotO804506e-70TGT3B_ARATH; Trihelix transcription factor GT-3b
TrEMBLK4CQ460.0K4CQ46_SOLLC; Uncharacterized protein
STRINGSolyc09g005560.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP22621535
AsteridsOGEA41872343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.19e-53Trihelix family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]