PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc09g005030.1.1
Common NameLOC101257998
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 147aa    MW: 16469.6 Da    PI: 7.1969
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc09g005030.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.13.5e-3262115255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         +rlrWtpeLH rFv+ave+LGG+++AtPk +l++m++kgL+++hvkSHLQ++R+
  Solyc09g005030.1.1  62 ARLRWTPELHLRFVHAVERLGGQDRATPKLVLQMMNIKGLSIAHVKSHLQMFRS 115
                         79***************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.3E-3058116IPR009057Homeodomain-like
PROSITE profilePS5129411.95858118IPR017930Myb domain
SuperFamilySSF466898.78E-1661117IPR009057Homeodomain-like
TIGRFAMsTIGR015575.9E-2362117IPR006447Myb domain, plants
PfamPF002492.7E-1063113IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MLEDSGETGC NSKTSCNFEN EVLEENDASS KFKDGGSSSE STLEESEKIK PCVRPYVRSK  60
MARLRWTPEL HLRFVHAVER LGGQDRATPK LVLQMMNIKG LSIAHVKSHL QMFRSKKTDD  120
QSQGIGHHHK LFMEGGDPNI QYDPIP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-1962117358Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-1962117358Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-1962117257Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-1962117257Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-1962117257Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-1962117257Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-1962117358Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-1962117358Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-1962117358Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-1962117358Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-1962117358Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-1962117358Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc09g005030.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2401976e-29Solanum lycopersicum strain Heinz 1706 chromosome 10 clone hba-208l2 map 10, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004246781.11e-107probable transcription factor KAN2
TrEMBLM1CJ608e-82M1CJ60_SOLTU; Uncharacterized protein
STRINGSolyc09g005030.1.11e-106(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43822141
Representative plantOGRP28515123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.12e-44G2-like family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]