PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc08g083230.1.1
Common NameLOC101249846
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRF
Protein Properties Length: 399aa    MW: 43707.7 Da    PI: 7.8292
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc08g083230.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC75.17.5e-24124167144
                 WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                         d+ep+rC+RtDGKkWRCsr+v +++k+CErH h+++ rsrk++e
  Solyc08g083230.1.1 124 DPEPWRCKRTDGKKWRCSRDVAPDQKYCERHAHKSKPRSRKPVE 167
                         79***************************************987 PP

2QLQ37.29.2e-1474108236
                 QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36 
                         +FTa+Qlq++ +Q  + Ky++a++PvPp+Ll++++
  Solyc08g083230.1.1  74 PFTASQLQEFQRQFIICKYIMASMPVPPHLLLPLP 108
                         9*******************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009518.5E-773109IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.0E-1174107IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166618.00474109IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.911124168IPR014977WRC domain
PfamPF088793.0E-19125167IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0009941Cellular Componentchloroplast envelope
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MEKGENTELL DLKMKTSEVS YPNKRTMFMA PSSHPYFLKE TADDGGSGGS GPEKYVGSDV  60
VSSGASNTCA RKVPFTASQL QEFQRQFIIC KYIMASMPVP PHLLLPLPSP PQSNMDLKFS  120
SGSDPEPWRC KRTDGKKWRC SRDVAPDQKY CERHAHKSKP RSRKPVEIHT NPSPKSNNRH  180
SFQFPTVQPS NDQTRCIEWL GRGDTCGTIP VDDNCNKQLM QSIGFNTRNS PAFQVQHEPK  240
LYPMNFNQYM CNSSSDQALA SQLKNEHCNN SIIASLQGRG TTSNAWPKDG ISSNGSFTSL  300
TLSMSGWNGG MDDDNKHAQA GIRMLDSERS GDEVLRSQWL NPVSWMSSTA PGGPLGEALC  360
LGNASSLRSP HGYSNSSATS SCSFDSCENG SHGLDFIG*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc08g083230.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0092610.0Solanum lycopersicum genomic DNA, chromosome 8, clone: C08HBa0005L01, complete sequence
GenBankAP0092800.0Solanum lycopersicum genomic DNA, chromosome 8, clone: C08HBa0201M14, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004246083.10.0growth-regulating factor 8-like
TrEMBLA0A3Q7IRD80.0A0A3Q7IRD8_SOLLC; Uncharacterized protein
STRINGSolyc08g083230.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA125171820
Representative plantOGRP4601684
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24150.17e-28growth-regulating factor 8
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]