PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc08g082750.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Nin-like
Protein Properties Length: 1612aa    MW: 180949 Da    PI: 6.5764
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc08g082750.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.75.6e-29578629152
              RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         aek+isle+l++yF++++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  Solyc08g082750.2.1 578 AEKTISLEVLQQYFAGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 629
                         589***********************************************97 PP

2RWP-RK54.52.2e-1714381485350
              RWP-RK    3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkik 50  
                          ++++ +dl+++F++++ dAAk+L+++ ++LKr CR+yGI+RWP  k k
  Solyc08g082750.2.1 1438 DSVNYDDLKQHFDKNLSDAAKSLQISRSTLKRLCRKYGIRRWPLSKRK 1485
                          678899*************************************86654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.655566649IPR003035RWP-RK domain
PfamPF020425.9E-26581629IPR003035RWP-RK domain
SuperFamilySSF542771.18E-22882969No hitNo description
SMARTSM006661.8E-22883965IPR000270PB1 domain
PROSITE profilePS5174523.655883965IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.9E-25883964No hitNo description
CDDcd064076.89E-36884964No hitNo description
PfamPF005641.2E-17884964IPR000270PB1 domain
PROSITE profilePS5151914.61814241509IPR003035RWP-RK domain
PfamPF020424.9E-1714401486IPR003035RWP-RK domain
Gene3DG3DSA:1.10.10.608.0E-614491476IPR009057Homeodomain-like
SuperFamilySSF542774.21E-1715171602No hitNo description
Gene3DG3DSA:3.10.20.2401.1E-1615191602No hitNo description
SMARTSM006661.0E-1115211603IPR000270PB1 domain
PROSITE profilePS5174518.62515211603IPR000270PB1 domain
PfamPF005643.4E-1315221601IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0010118Biological Processstomatal movement
GO:0010167Biological Processresponse to nitrate
GO:0042128Biological Processnitrate assimilation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1612 aa     Download sequence    Send to blast
MSEPEEEMNF IFRSKPKDFV HPPPATAAAI FAAAASASNP MSPFLVSAAS EQPCSPLWAF  60
SDENEDKPNG NALSTGSLRL SNYPRFVTYA NEHEAAPETV SVTDDKKRIP PPIKGLAPLD  120
YLDSSCIIKE RMTQALRYFK ESTGERVLAQ VWAPVKNGGR YVLTTSGQPF VLDPDCNGLH  180
QYRMVSLMYM FSVDGETDGV LGLPGRVYRK KLPEWTPNVQ YYSSKEFPRL NHALDYNVRG  240
TLALPVFEPS GQSCVGVLEL IMTSQKINYA PEVDKVCKAL EAVNLKSSEI LDYPNHQICN  300
EGRQNALVEI LEILTAVCET YKLPLAQTWV PCRHRSVLAD GGGFKKSCSS FDGSCMGQVC  360
MSTTDVAFYV VDAHMWGFRE ACAEHHLQKG QGVAGRAYAS QKSCFCEDIG KFCKTEYPLV  420
HYARLFGLSR CFAICLRSTH TGNDDYILEF FLPPNDGDYT DQLALLNSLL LTMKQHFRSL  480
RVASGEELEH DWGSVEIIKA STEEKLGSRF DSVPTTKSLP QSASVANGRR HPDLMEEQHS  540
TVAKGAEGVN VTAEAHNHAS VPQNKQTGKK SERKRGKAEK TISLEVLQQY FAGSLKDAAK  600
SLGVCPTTMK RICRQHGISR WPSRKINKVN RSLSKLKRVI ESVQGADGTF SLTSLAPNSL  660
PVAVGSISWP AGINGSPCKA SEYQEEKNEF SNHGTPGSHE EAEPTDQMLG SRIIGNEELS  720
PKLNGFVREG SHRSRTGSFS REESTGTPTS HGSCQGSPSP ANESSPQNEL LNSPTQESVM  780
KVEGSLEPAR QTTGELNLST AFLMPGLFIP EHTHQQFRGM LVEDAGSSHD LRNLCPAGET  840
MFDERVPEYS WTNPPCSNGI ATNQVPLPVE KMPQFSSRPE VTSVTIKATY REDIIRFRLC  900
LNSGIYKLKE EVSKRLKLEM GTFDIKYLDD DHEWVLIACD ADLQECIDIS SSSGSNVVRL  960
LVHDIMPNLG SSCESSGVKE KIKLALQRIE TSQVILLQFW GLENIEGRKF LSTSGQPFGL  1020
RYLYKGLCWY RKHCQGYKYS VDKGENHEQG MEKTHLFGPP TRVFQQKLPE SSTHVGYYTN  1080
EEFPMRDHVL QCGVRTYLAL PVFEPVDKNC IGVIELVTVW KGGYLTCEVE RVLNPLEAVD  1140
LKCPKIFLNK DRKVQAEKYN EGEEFKRMLK IVRETHKLPF IRVWIPCVNL EMDHNGMYVG  1200
CTELAMSASN EVYFVADEEM DANDHVYDDY YYDDMLCFRD ISKLQPLQKD QGVVGKAFSS  1260
GKLCYCTNIT EFSIIEYPLV HYARWCGLTT SFAICLKSRD DAYILELFLP PDNGDPNMLL  1320
GSILTTMGQH FQNFKFASGQ ELGNDSSVQV VKASSDKNVD YFHIYQTRDS SFMPEVLHVE  1380
DSRNQLMEGN ENHMEKKEDR KQSMVQSNVL SIDSHVISEK QCVSVSHLQK ESRTRTKDSV  1440
NYDDLKQHFD KNLSDAAKSL QISRSTLKRL CRKYGIRRWP LSKRKKSSES DQQTLTKVSK  1500
KNKSIGSETT TQKDHESCSS SFTVKATFGD DMMKFKLYTF SRKDDLDNEV SKRLKLPIGR  1560
FRINYMDEDN DWIWIACDDD LSDCFNNAQS LGNNTIKMLV LPAAINHHFE L*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.225580.0flower| leaf
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves, flowers and siliques. Detected in root hairs, emerging secondary roots, vascular tissues, leaf parenchyma cells and stomata. {ECO:0000269|PubMed:18826430}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in regulation of nitrate assimilation and in transduction of the nitrate signal. {ECO:0000269|PubMed:18826430}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00449DAPTransfer from AT4G24020Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc08g082750.2.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not regulated by the N source or by nitrate. {ECO:0000269|PubMed:18826430}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0093970.0Solanum lycopersicum genomic DNA, chromosome 8, complete sequence, clone: C08SLm0010D08
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004245486.10.0protein NLP7-like
SwissprotQ84TH90.0NLP7_ARATH; Protein NLP7
TrEMBLA0A3Q7HUP00.0A0A3Q7HUP0_SOLLC; Uncharacterized protein
STRINGSolyc08g082750.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52232239
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Xu N, et al.
    The Arabidopsis NRG2 Protein Mediates Nitrate Signaling and Interacts with and Regulates Key Nitrate Regulators.
    Plant Cell, 2016. 28(2): p. 485-504
    [PMID:26744214]
  3. Karve R,Suárez-Román F,Iyer-Pascuzzi AS
    The Transcription Factor NIN-LIKE PROTEIN7 Controls Border-Like Cell Release.
    Plant Physiol., 2016. 171(3): p. 2101-11
    [PMID:27221617]
  4. Yu LH, et al.
    Overexpression of Arabidopsis NLP7 improves plant growth under both nitrogen-limiting and -sufficient conditions by enhancing nitrogen and carbon assimilation.
    Sci Rep, 2016. 6: p. 27795
    [PMID:27293103]
  5. Menz J,Li Z,Schulze WX,Ludewig U
    Early nitrogen-deprivation responses in Arabidopsis roots reveal distinct differences on transcriptome and (phospho-) proteome levels between nitrate and ammonium nutrition.
    Plant J., 2016. 88(5): p. 717-734
    [PMID:27419465]
  6. Yan D, et al.
    NIN-like protein 8 is a master regulator of nitrate-promoted seed germination in Arabidopsis.
    Nat Commun, 2016. 7: p. 13179
    [PMID:27731416]
  7. Guan P, et al.
    Interacting TCP and NLP transcription factors control plant responses to nitrate availability.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(9): p. 2419-2424
    [PMID:28202720]
  8. Liu KH, et al.
    Discovery of nitrate-CPK-NLP signalling in central nutrient-growth networks.
    Nature, 2017. 545(7654): p. 311-316
    [PMID:28489820]
  9. Li Z, et al.
    The Arabidopsis CPSF30-L gene plays an essential role in nitrate signaling and regulates the nitrate transceptor gene NRT1.1.
    New Phytol., 2017. 216(4): p. 1205-1222
    [PMID:28850721]
  10. Cao H, et al.
    Overexpression of the Maize ZmNLP6 and ZmNLP8 Can Complement the Arabidopsis Nitrate Regulatory Mutant nlp7 by Restoring Nitrate Signaling and Assimilation.
    Front Plant Sci, 2017. 8: p. 1703
    [PMID:29051766]
  11. Konishi N,Okubo T,Yamaya T,Hayakawa T,Minamisawa K
    Nitrate Supply-Dependent Shifts in Communities of Root-Associated Bacteria in Arabidopsis.
    Microbes Environ., 2017. 32(4): p. 314-323
    [PMID:29187692]
  12. Karve RA,Iyer-Pascuzzi AS
    Further insights into the role of NIN-LIKE PROTEIN 7 (NLP7) in root cap cell release.
    Plant Signal Behav, 2018. 13(1): p. e1414122
    [PMID:29215953]
  13. Zhao L, et al.
    The Arabidopsis NLP7 gene regulates nitrate signaling via NRT1.1-dependent pathway in the presence of ammonium.
    Sci Rep, 2018. 8(1): p. 1487
    [PMID:29367694]