PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc08g082630.2.1
Common NameARF9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ARF
Protein Properties Length: 645aa    MW: 72370.5 Da    PI: 7.9763
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc08g082630.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B371.21.4e-22116216198
                         EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                         f+kvlt sd++++g +++ +k+a+e+      ++++  +++l+ +d++  +W++k+i+r++++r++lt+GW+ Fv++++L +gD++vF   
  Solyc08g082630.2.1 116 FCKVLTASDTSTHGGFSVLRKHANEClppldlNQQT-PTQELIAKDLHDVEWRFKHIFRGQPRRHLLTTGWSTFVSSKKLVAGDSFVFL-- 203
                         99****************************973333.3459************************************************.. PP

                         SSSEE..EEEEE- CS
                  B3  86 grsefelvvkvfr 98 
                         + ++++l+v+v r
  Solyc08g082630.2.1 204 RGNNGQLRVGVKR 216
                         3478888999865 PP

2Auxin_resp96.25e-32242321183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         a+ha++t+++F v+Y+Pr+  ++F+v v+k+++alk++++vGmRfkm+fe e  + rr++Gt+vg+ dl++ +W+nS WrsLk
  Solyc08g082630.2.1 242 ASHAVTTQTMFVVYYKPRT--TQFIVGVNKYLEALKHEYAVGMRFKMQFEAEGNPDRRFMGTIVGIDDLSS-QWKNSAWRSLK 321
                         789***************6..9**********************************************777.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.0E-39108231IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.22E-40109245IPR015300DNA-binding pseudobarrel domain
CDDcd100173.01E-20114216No hitNo description
SMARTSM010193.3E-21116218IPR003340B3 DNA binding domain
PROSITE profilePS5086311.307116218IPR003340B3 DNA binding domain
PfamPF023621.2E-20116216IPR003340B3 DNA binding domain
PfamPF065075.0E-30242321IPR010525Auxin response factor
PfamPF023091.9E-7541587IPR033389AUX/IAA domain
SuperFamilySSF542773.14E-11546626No hitNo description
PROSITE profilePS5174521.872550631IPR000270PB1 domain
PfamPF023092.7E-5596636IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 645 aa     Download sequence    Send to blast
MNSPGKKDAL YHELWQLCAG PVVDVPREGE RVYYFPQGHM EQLVASINQE MDQRVPSFNL  60
KSKVLCRVIN SHFLAEEDND EVYVQITLMP EAPHVPEPTT PDPLIPQDVK PRFHSFCKVL  120
TASDTSTHGG FSVLRKHANE CLPPLDLNQQ TPTQELIAKD LHDVEWRFKH IFRGQPRRHL  180
LTTGWSTFVS SKKLVAGDSF VFLRGNNGQL RVGVKRLVRQ QSSMPSSVMS SQSMHLGVLA  240
TASHAVTTQT MFVVYYKPRT TQFIVGVNKY LEALKHEYAV GMRFKMQFEA EGNPDRRFMG  300
TIVGIDDLSS QWKNSAWRSL KVRWDEPAAI ARPDRVSPWE IKPYVCSIPN VLVPPTAEKN  360
KRHRLHSEIK ISEQPSSSNA SAVWNPSLRS PQFNTFGINS STNCALASLT ESGWQLPHLN  420
TSGMLVDEPE DGRSAPTWCG FPCVLAPQFG QGTNQPIVIP TDGRKCDTKK TCRLFGIDLK  480
SSSISTTEAR LQLQPAGISC VFAERAPPNT VPAGDSDQKS ELSVDFKDQM QGHLRLPLKE  540
VQSKQSCSTR SRTKVQMQGV AVGRAVDLTI LKGYDELTKE LEEMFEIQGE LQSRQKWGIL  600
FTDDEGDTML MGDYPWQDFC NVVRKIFICS SQDMKKLTLS RADS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-164834317354Auxin response factor 1
4ldw_A1e-164834317354Auxin response factor 1
4ldw_B1e-164834317354Auxin response factor 1
4ldx_A1e-164834317354Auxin response factor 1
4ldx_B1e-164834317354Auxin response factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.52860.0flower
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the whole plant. {ECO:0000269|PubMed:10476078}.
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Function -- GeneRIF ? help Back to Top
  1. ARF9 negatively controls cell division during early fruit development in tomato.
    [PMID: 25883382]
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc08g082630.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0136390.0Lycopersicon esculentum clone 132441R, mRNA sequence
GenBankHM0372500.0Solanum lycopersicum cultivar Zhongshu No. 6 auxin response factor 9 (ARF9) mRNA, complete cds
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001234534.10.0auxin response factor 9
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLD7R6050.0D7R605_SOLLC; Auxin response factor
STRINGSolyc08g082630.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23472450
Representative plantOGRP5501582
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Wu J, et al.
    Identification, isolation and expression analysis of auxin response factor (ARF) genes in Solanum lycopersicum.
    Plant Cell Rep., 2011. 30(11): p. 2059-73
    [PMID:21735233]
  3. de Jong M, et al.
    Solanum lycopersicum AUXIN RESPONSE FACTOR 9 regulates cell division activity during early tomato fruit development.
    J. Exp. Bot., 2015. 66(11): p. 3405-16
    [PMID:25883382]