PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc08g081400.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family TALE
Protein Properties Length: 645aa    MW: 72650.5 Da    PI: 6.7113
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc08g081400.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.17.2e-094154521954
                         HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
            Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                         Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  Solyc08g081400.2.1 415 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 452
                         554459******************************88 PP

2BELL1153.7e-37276344472
                BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                         elqk+k+kLl++leeVd+rYk+y++q++ v+ssFeavag g+a++Y +lA++a+SrhFrcL+d i+ qi
  Solyc08g081400.2.1 276 ELQKRKTKLLQMLEEVDRRYKHYCDQMKGVVSSFEAVAGNGAATVYSALASRAMSRHFRCLRDGIVAQI 344
                         89*****************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.4E-51214342IPR006563POX domain
PfamPF075264.9E-44220340IPR006563POX domain
PROSITE profilePS5007112.082393456IPR001356Homeobox domain
SMARTSM003895.8E-9396460IPR001356Homeobox domain
CDDcd000862.85E-11396457No hitNo description
SuperFamilySSF466895.56E-17397462IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-27399462IPR009057Homeodomain-like
PfamPF059208.6E-18413452IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 645 aa     Download sequence    Send to blast
MASHHQESII REEIKPRSSS MVTSTGYWFS SDTNNQNPTP HNNIVNHQLQ NFETNPDLYN  60
LSSSTTSSMD QMMIGFPPNN NNPHHVLWKG NFPNKINGVV VDDDDDDHGP SSSKNISEQF  120
YQHETMLATT TTSHQDSWHH DNNRTLLVDD PSMRCVFPCE GNERPSQGLS LSLCSSNPSS  180
IGLQSFELRH QDLQQGLIHD GFLGKSTSIQ QGYFHHYHQV RDSKYLGPAQ ELLSEFCSLG  240
IKKNNDHSSS KLLLKQHDTT ATTSKKQLLQ SLDLLELQKR KTKLLQMLEE VDRRYKHYCD  300
QMKGVVSSFE AVAGNGAATV YSALASRAMS RHFRCLRDGI VAQIKATKMA MGEKDSTTTL  360
IPGSTRGETP RLRLLDQTLR QQKAFQQMNM METHPWRPQR GLPERSVSVL RAWLFEHFLH  420
PYPSDVDKHI LARQTGLSRS QVSNWFINAR VRLWKPMVEE MYLEETKEEE EENVGSQDGS  480
KALIDEMTIN NHQSSHIDQK PNLVRIESEC ISSIINHHPH DKNDQNYGVI RGGDQSFGAI  540
ELDFSTNIAY ATNGSDHHHH HHGGGGGSGG VSLTLGLQQH GGSSMGLTTF SSQPSHHNHN  600
HQSSLFYPRD DHDQVQYSSL LDSENQNLPY RNLMGAQLLH DLAG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-15402460563Homeobox protein Meis2
3k2a_B1e-15402460563Homeobox protein Meis2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.43150.0flower| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ2612420.0Solanum lycopersicum cultivar Rio Grande PtoR Hop-interacting protein THI035 mRNA, complete cds
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010325299.10.0PREDICTED: bell-like homeodomain protein 3 isoform X1
SwissprotQ388971e-142BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLK4CPD70.0K4CPD7_SOLLC; Uncharacterized protein
STRINGSolyc08g081400.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53001317
Representative plantOGRP13316172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-107TALE family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]