PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc08g079800.2.1
Common NameLOC101243919
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRF
Protein Properties Length: 219aa    MW: 24785.6 Da    PI: 8.7798
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc08g079800.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC72.74.1e-23111153143
                 WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrksk 43 
                         ++epgrC+RtDGKkWRCs+ v++++k+CE+H+hrgr+rsrk +
  Solyc08g079800.2.1 111 EPEPGRCKRTDGKKWRCSKGVVQNQKYCEKHMHRGRQRSRKCM 153
                         69**************************************965 PP

2QLQ422.9e-155084337
                 QLQ  3 FTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                        FT  Q q+L++Q  +yKy+ a++PvP +L+ +i+k
  Solyc08g079800.2.1 50 FTFLQRQELEQQFIIYKYIEAGLPVPTHLIIPIYK 84
                        9999*****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009519.3E-54884IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166618.9664984IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088808.1E-125082IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166723.33111155IPR014977WRC domain
PfamPF088795.8E-19112151IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MELKISPPKS IATKKVCYNV SDGGEKCSIE LGFKNLELSY SNFSTNGYGF TFLQRQELEQ  60
QFIIYKYIEA GLPVPTHLII PIYKSFTCSL KGLHDVMGYG HVCWEHKSRM EPEPGRCKRT  120
DGKKWRCSKG VVQNQKYCEK HMHRGRQRSR KCMELTNSTD ICCSDSSKIL SQSCQILQKC  180
ATGKVSDMQP LIFLKSLNNI DHNSEPDTTT LSIGLPMN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1144152GRQRSRKCM
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc08g079800.2.1
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0092760.0Solanum lycopersicum genomic DNA, chromosome 8, clone: C08HBa0165B06, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004246135.11e-163growth-regulating factor 9-like
SwissprotQ6AWX76e-44GRF12_ORYSJ; Growth-regulating factor 12
TrEMBLA0A3Q7HT151e-109A0A3Q7HT15_SOLLC; Uncharacterized protein
STRINGSolyc08g079800.2.11e-163(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1447199
Representative plantOGRP4601684
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.15e-34growth-regulating factor 2
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]