PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc08g079120.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 308aa    MW: 35945.4 Da    PI: 8.612
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc08g079120.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.21.9e-5471361129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                         +ppGfrFhPtdeelv++yL+kk+++k+++l +vike+d+yk+ePwdL++  k+ + e++ewyfFs++dkky+tg+r+nratk+g+Wkatg+
  Solyc08g079120.1.1   7 VPPGFRFHPTDEELVDYYLRKKIASKRIDL-DVIKEIDLYKIEPWDLQElcKIGSeEQNEWYFFSHKDKKYPTGTRTNRATKAGFWKATGR 96 
                         69****************************.9***************954555552555******************************** PP

                 NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         dk++++ k+ lvg++ktLvfykgrap+g+k+d +mheyrle
  Solyc08g079120.1.1  97 DKAIYR-KQCLVGMRKTLVFYKGRAPNGQKSDYIMHEYRLE 136
                         ******.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-595157IPR003441NAC domain
PROSITE profilePS5100557.5867157IPR003441NAC domain
PfamPF023651.2E-278135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MNSFAHVPPG FRFHPTDEEL VDYYLRKKIA SKRIDLDVIK EIDLYKIEPW DLQELCKIGS  60
EEQNEWYFFS HKDKKYPTGT RTNRATKAGF WKATGRDKAI YRKQCLVGMR KTLVFYKGRA  120
PNGQKSDYIM HEYRLETNEN ANTIQEEGWA VCRVFKKKLA TSIRREGDQL YQHESLCWYN  180
DDQLVSNFTS NFDSPPRNNF PNPYNVTPSY HHQLPYNNMH QNPHNNDALF LQLPQLESPK  240
IPPSYGSINN NSMYNNNNNY DQVTDWRVLD KFVASQLSTQ QDGYNGACSS STLTLIYLRI  300
LKAILLI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-50615814169Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Up-regulated during xylem vessel element formation. Expressed preferentially in procambial cells adjacent to root meristem. {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
UniprotTISSUE SPECIFICITY: Detected in root vessels of protoxylems, outermost metaxylems, inner metaxylems, shoots and hypocotyls. Expressed in roots, hypocotyls, cotyledons and leaves (PubMed:18445131). Expressed in developing xylems (PubMed:16103214, PubMed:17565617). Specifically expressed in vessels in the secondary xylem of the root-hypocotyl region, and in vessels but not in interfascicular fibers in stems (PubMed:25148240). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:17565617, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:25148240}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc08g079120.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0093009e-67Solanum lycopersicum genomic DNA, chromosome 8, clone: C08SLm0012O12, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004246148.10.0NAC domain-containing protein 7
SwissprotF4HYV51e-121NAC26_ARATH; NAC domain-containing protein 26
TrEMBLA0A1U8F3D51e-174A0A1U8F3D5_CAPAN; NAC domain-containing protein 26
STRINGSolyc08g079120.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62700.11e-120Arabidopsis NAC domain containing protein 26
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]