PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc08g077230.2.1
Common NameLOC101261945
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ARR-B
Protein Properties Length: 561aa    MW: 62475.2 Da    PI: 6.3153
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc08g077230.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.46.6e-28317370256
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          +++WtpeLH++Fv+aveqL G+++A+P++il+lmkv+gLt+++v+SHLQkYR++
  Solyc08g077230.2.1 317 IKVDWTPELHKKFVQAVEQL-GIDQAIPSRILDLMKVEGLTRHNVASHLQKYRMH 370
                         5899****************.********************************96 PP

2Response_reg33.81.8e-12201261109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         vl+ d++ + +  +++ lek +y +v ++ + +eal+ +  k   +++ ++ ++  ++dG+  l+ +++++ +lp i+ +   + +++ ++
  Solyc08g077230.2.1  20 VLLLDEDSNSAAEMKSRLEKMDY-IVYSFCNESEALTAISSKSegFHVAIVEVSAGNSDGV--LRFLESAK-DLPTIMTSNIHSLSTMMKC 106
                         799999999**************.***************777777***************5..77777766.9*******9999******* PP

                         HHTTESEEEESS--HHHHHH CS
        Response_reg  90 lkaGakdflsKpfdpeelvk 109
                         + +Ga +fl Kp + ++l +
  Solyc08g077230.2.1 107 IALGAVEFLQKPLSDDKLKN 126
                         ****************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23004.0E-1716154No hitNo description
SuperFamilySSF521724.55E-1616140IPR011006CheY-like superfamily
SMARTSM004480.003218128IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011022.1119132IPR001789Signal transduction response regulator, receiver domain
PfamPF000725.0E-920126IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.49E-1021131No hitNo description
PROSITE profilePS5129415.85313372IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-27314373IPR009057Homeodomain-like
SuperFamilySSF466892.87E-18315373IPR009057Homeodomain-like
TIGRFAMsTIGR015578.8E-25316370IPR006447Myb domain, plants
PfamPF002497.2E-8319368IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 561 aa     Download sequence    Send to blast
MICIENELLG WKDFPKGLKV LLLDEDSNSA AEMKSRLEKM DYIVYSFCNE SEALTAISSK  60
SEGFHVAIVE VSAGNSDGVL RFLESAKDLP TIMTSNIHSL STMMKCIALG AVEFLQKPLS  120
DDKLKNIWQH VVHKAFNTRK DVSKSLEPVK DSVLSMLQLQ LEMGEADDKS SNGTEPPTAV  180
AESNTEQSSG CDKYPAPSTP QLKQGVRSVD DGDCHDHTIF STDQDSGEHD ADTKSVETTY  240
NNSLAENNVQ TSPTVQQGDI ILKEDNVSSP DLKTETDIAT TSRSNDCPDN SIMHSAEPSK  300
ASGPHSSNGT KSNRKKIKVD WTPELHKKFV QAVEQLGIDQ AIPSRILDLM KVEGLTRHNV  360
ASHLQKYRMH RKQILPKEVE RRWPNPQPID SVQRSYYPHK PIMTFPQYHS NHVAPGGQFY  420
PAWVTPASYP NGLQVWGSPY YPGWKPAETW HWTPRPELHA DTWGSPIMSP SLGSYPPYPQ  480
NAGVYRPHGT HNRYSMLEKS FDLHPADEVI DKVVKEAITK PWLPLPLGLK APSTESVLDE  540
LSRQGISTIP SQINDSRCRR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A5e-17321372657Transcription factor LUX
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.15940.0flower| fruit| leaf| stem
Function -- GeneRIF ? help Back to Top
  1. Analysis of the transcriptome of transgenic lines overexpressing the tomato APPR2-Like gene revealed upregulation of several ripening-related genes in the overexpression lines, providing a link between the expression and the ripening process. [APRR2-like]
    [PMID: 23292788]
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc08g077230.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0136480.0Lycopersicon esculentum clone 132455F, mRNA sequence
GenBankKC1476340.0Solanum lycopersicum APRR2-like protein mRNA, complete cds
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001266246.10.0two-component response regulator-like APRR2-like
RefseqNP_001304014.10.0two-component response regulator-like APRR2-like
TrEMBLK4CN830.0K4CN83_SOLLC; APRR2-like protein
STRINGSolyc08g077230.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA56731531
Representative plantOGRP9166813
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18020.61e-132ARR-B family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Pan Y, et al.
    Network inference analysis identifies an APRR2-like gene linked to pigment accumulation in tomato and pepper fruits.
    Plant Physiol., 2013. 161(3): p. 1476-85
    [PMID:23292788]