PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc08g076400.2.1
Common NameLOC101243626
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 264aa    MW: 29612.3 Da    PI: 9.4662
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc08g076400.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.45.6e-32169222255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         pr+rWt++LH++Fv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Solyc08g076400.2.1 169 PRMRWTSTLHAHFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 222
                         9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.23E-15166222IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-28166222IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-23169222IPR006447Myb domain, plants
PfamPF002491.9E-6170221IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MELFPAQPDL SLKISPPNIK PSSSTWKRKI TSEDDIHMDL GFCKRAHVVE STNPINTSSS  60
SCFDLSLSNN PTKPNPNSSH HLHNLQNYNI SQQNQTIIRG IPVYHQKPFN TTTTTTFPIT  120
CSPCSIINNN NIKNTISSCA STRPNFQQGG FFRSRFLSRY STKRSTRAPR MRWTSTLHAH  180
FVHAVELLGG HERATPKSVL ELMDVKDLTL AHVKSHLQMY RTVKTTDRSA SSGQSEVFDN  240
LSSGDTSEEL MVDEYFDPKS KLI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A6e-18170224458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B6e-18170224458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A6e-18170224458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C6e-18170224458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D6e-18170224458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F6e-18170224458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H6e-18170224458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J6e-18170224458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in developing phloem. {ECO:0000269|PubMed:14561401}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates lateral organ polarity. Promotes abaxial cell fate during lateral organd formation. Functions with KAN1 in the specification of polarity of the ovule outer integument. {ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:15286295, ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:17307928}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc08g076400.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0092920.0Solanum lycopersicum genomic DNA, chromosome 8, clone: C08HBa0320P23, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004245982.10.0probable transcription factor KAN2
SwissprotQ9C6163e-64KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A3Q7HRP20.0A0A3Q7HRP2_SOLLC; Uncharacterized protein
STRINGSolyc08g076400.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27382255
Representative plantOGRP5701580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.16e-49G2-like family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]