PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc08g074860.1.1
Common NameLOC104648988
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 411aa    MW: 45732.9 Da    PI: 6.0285
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc08g074860.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_121.45.4e-07165226162
                         XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                         ek+ k+  ++++ R+ ++ +R R+k ++e+Le+ v ++++  ++L   +++l+ e a+lk++
  Solyc08g074860.1.1 165 EKDEKKKSKLERDRVNSQTYRNRRKHYVEKLEDNVRTMQSTIQELNRMISHLTLENATLKTQ 226
                         7899*******************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.7E-9162227No hitNo description
SMARTSM003387.3E-5165229IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.852167230IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.05E-6169227No hitNo description
CDDcd147047.70E-9176221No hitNo description
SuperFamilySSF549282.82E-27316406IPR012677Nucleotide-binding alpha-beta plait domain
Gene3DG3DSA:3.30.70.3305.1E-25323405IPR012677Nucleotide-binding alpha-beta plait domain
PROSITE profilePS5010218.086327405IPR000504RNA recognition motif domain
CDDcd124089.17E-40328403No hitNo description
SMARTSM003602.0E-24328401IPR000504RNA recognition motif domain
PfamPF000765.8E-19329395IPR000504RNA recognition motif domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006413Biological Processtranslational initiation
GO:0000166Molecular Functionnucleotide binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MENSDKPLEN DSSGVPVPPP DNGINNDSNV ESAAQKDEVM LDDVETEIDL SIDDVFPPPD  60
VEYLNESPES SNRKASMESG NGYSINLNYP SLEYQHSGNC GMNNLVNSSP NVVNNSVKCG  120
VVDEQQIRLK DLKRKKVSDD SNNAFKHEKS EFVVDGSNIR NVSSEKDEKK KSKLERDRVN  180
SQTYRNRRKH YVEKLEDNVR TMQSTIQELN RMISHLTLEN ATLKTQMGST SQIPPPHGMN  240
PYHTIRSPWM FDGPPYMARP QGSQVPHIVI KPIPRKPQAV APPMSREAPA AGAGSQKSAY  300
FPPIMTGGAS TSRSGEGTEM RRRNDENSVR ITNISENTRE ADLLELFCPF GHVNGVYVAI  360
DQNTGMSRGF GFVNFVNRED AERAINKLNG HSYHNLILRV EWAAPSVCFP *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cq0_A7e-25314406395Eukaryotic translation initiation factor 3 subunit 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.32581e-108flower| fruit| leaf| stem| trichome
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc08g074860.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010325641.10.0bZIP transcription factor 17-like
TrEMBLA0A3Q7HQR80.0A0A3Q7HQR8_SOLLC; Uncharacterized protein
STRINGSolyc08g074860.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1861444
Representative plantOGRP21711628
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56660.16e-19basic region/leucine zipper motif protein 49
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]