PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc08g069160.2.1
Common NameLOC101249843
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Trihelix
Protein Properties Length: 317aa    MW: 36259.5 Da    PI: 5.2181
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc08g069160.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix28.73.5e-091886270
            trihelix  2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekk 70
                        Wt +e  +L++  + ++ + +++ +  ++W++   ++ + g++rs +qCk +we++  +y k+k +e+ 
  Solyc08g069160.2.1 18 WTLHESVTLVNEMKATQIECGNSLASFQKWQSTVHNCNSLGVNRSLNQCKRRWESMLEQYNKVKPWESA 86
                        9999999999999999999****9****************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138379.2E-81785No hitNo description
PROSITE profilePS500906.4351874IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009506Cellular Componentplasmodesma
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MERSGGSLRT RSQAAPDWTL HESVTLVNEM KATQIECGNS LASFQKWQST VHNCNSLGVN  60
RSLNQCKRRW ESMLEQYNKV KPWESAYWDS FDEERKRELE LPEQFDFELF NAIARYLSLE  120
GEDGGGAETD PDTDPEAQQV QGNNAFLEIG PKRQRRRTKT KRYKIEERLN PWRRILNENR  180
KYEQSKMGIK HEASIDAGLE APRHENSSLE IKRETSSPEE MTELPNLSMV NKVKAEQFHV  240
DNPEELMAAT LRENAEMITA ITEGNTMDDR DCSLAGLNNF DAGRLHLIRS QGNQLIDCLG  300
KISDTLIQLC DAIHKK*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.10850.0flower| fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0109440.0Solanum lycopersicum DNA, chromosome 8, clone: C08SLm0007C12, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004245311.10.0PREDICTED: uncharacterized protein LOC101249843
TrEMBLK4CMD60.0K4CMD6_SOLLC; Uncharacterized protein
STRINGSolyc08g069160.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA83602124
Representative plantOGRP74821314
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31270.17e-45sequence-specific DNA binding transcription factors
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]