PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc08g068760.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRF
Protein Properties Length: 156aa    MW: 17395.8 Da    PI: 8.7185
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc08g068760.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC59.17.2e-19106139235
                 WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrg 35 
                          epgrC+RtDGK WRCsr+v + kk CE+H+hrg
  Solyc08g068760.1.1 106 LEPGRCKRTDGKNWRCSRDVAPHKKSCEHHMHRG 139
                         69*******************************8 PP

2QLQ483.9e-174781236
                 QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                        +FT+aQ+ +L +Q+++yKy+++ + vPp+Ll+ i+
  Solyc08g068760.1.1 47 PFTWAQWKELDRQAMIYKYMVSAMSVPPDLLLSIF 81
                        9********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.2E-94682IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.1E-114781IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166619.0354782IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166719.026105151IPR014977WRC domain
PfamPF088793.1E-15107139IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MENSKNCYTI CSTDEANLLP LPPSTAVVRS FDVATNSQGM ATALGYPFTW AQWKELDRQA  60
MIYKYMVSAM SVPPDLLLSI FSGASHTTSA TGSVQGQRYT TNIRDLEPGR CKRTDGKNWR  120
CSRDVAPHKK SCEHHMHRGL SILKDGNLIQ VYIYF*
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed during the early stages of leaf development and expression decreases with the maturation of the leaf. {ECO:0000269|PubMed:20023165}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues. Component of a network formed by miR396, the GRFs and their interacting factors (GIFs) acting in the regulation of meristem function, at least partially through the control of cell proliferation. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc08g068760.1.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: microRNA 396 (miR396a or miR396b) negatively regulates growth-regulating factors (GRF1-4 and GRF7-9). {ECO:0000269|PubMed:15200956, ECO:0000269|PubMed:19453503, ECO:0000269|PubMed:20023165}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0109400.0Solanum lycopersicum DNA, chromosome 8, clone: C08HBa0195L01, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015068264.16e-79growth-regulating factor 3-like isoform X1
RefseqXP_027771148.16e-79growth-regulating factor 3-like isoform X2
SwissprotQ9FJB83e-26GRF7_ARATH; Growth-regulating factor 7
TrEMBLA0A3Q7ILA51e-115A0A3Q7ILA5_SOLLC; Uncharacterized protein
STRINGSolyc08g068760.1.11e-115(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA70322230
Representative plantOGRP4601684
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.12e-26growth-regulating factor 7
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Cao Y,Han Y,Jin Q,Lin Y,Cai Y
    Comparative Genomic Analysis of the GRF Genes in Chinese Pear (Pyrus bretschneideri Rehd), Poplar (Populous), Grape (Vitis vinifera), Arabidopsis and Rice (Oryza sativa).
    Front Plant Sci, 2016. 7: p. 1750
    [PMID:27933074]