PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc08g062200.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Nin-like
Protein Properties Length: 753aa    MW: 84597.1 Da    PI: 6.9253
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc08g062200.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK60.33.6e-19256306252
              RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         +k ++++d + y +l+i++A  +L++c+Tv+Kr CR+ G++RWP+Rki+s+
  Solyc08g062200.1.1 256 TKMMNVKDFEDYLHLSIQEAGIKLNLCPTVMKRVCRRDGLRRWPSRKINSI 306
                         688999*******************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151914.971246326IPR003035RWP-RK domain
PfamPF020428.4E-17259306IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 753 aa     Download sequence    Send to blast
MDNFDTSIVP YHDPFDDNIL TGLNFSLFDD ENPTIDGDIN YQVPINLNPT IVGGDNNNHQ  60
GPPINENKTN LNYSLSFPDY DPYLLEISFD SGDGFIGGST NPEGEVPGNN NCQILREIIH  120
DNGMILSKIG IFGTIGRISH AIVEKSTMDD HMSSDTIDFS NDSISKVKEF LVQYFEGCKK  180
DGYIVLEDTL SEFYQTLSVN SGVRTNDINN LLQLSTTNLH HNVLTEQQGM ANENEGTNSG  240
VNRGKISLSE QQRRRTKMMN VKDFEDYLHL SIQEAGIKLN LCPTVMKRVC RRDGLRRWPS  300
RKINSIKRKI SKRQESLNSI HAGERKSAKA DIAKLEKELA AIYNDLTYSL TKRVHQCLIY  360
MKLLRLLKKY YCSIFKKKMA SVEKVVGVKK VRQKDSDGWD VSMPLPGDII EGVAELASDD  420
DSFIQAKAWS ELTLFLGKIA GHFIWFKVRR GESTLKLKGY VLVERRSNLQ KRFVVRAASD  480
ERHLAVIAEL TLGRCTELQE MSRRMVNSGS RGYNQMGLQY DWKMKVGTYL PDSHSTVVSS  540
IVFMPLTREY RVEATLVRTM AWFSAAVSSG IPLVFVNIQT EQINNLERRN TSGKDVCSRQ  600
LDGYVGYHQS AQGVRLWYLP GIEEVPLELT PEPGESRFGI DIKRTDEGFV SIYSVAKGTA  660
AERAGLVHLF EEANKSKHHV VISRLEGKSV LPSTVSSEGL IYCCDHADIK DTLDLAMERS  720
ESIRLHIMSW PNQITQNTTG LFGAAAALMP PN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc08g062200.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0095180.0Solanum lycopersicum DNA, chromosome 8, clone: C08HBa0067I16, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010325012.10.0uncharacterized protein LOC104648819
TrEMBLA0A3Q7HPR40.0A0A3Q7HPR4_SOLLC; Uncharacterized protein
STRINGSolyc08g062200.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35052027
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.17e-08Nin-like family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]