PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc08g022080.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 142aa    MW: 15916 Da    PI: 8.5086
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc08g022080.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.66.2e-142511059
                        HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1 10 kqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59
                        + +NRe+ArrsR+RK+a + eLe+ v +   eN++L k+l  +++++ + 
  Solyc08g022080.2.1  2 MLSNRESARRSRRRKQAHLTELETQVSQVRVENSSLLKRLTDISQKYNEA 51
                        679***********************************999999988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS502179.622150IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.17E-10247No hitNo description
SMARTSM003383.2E-9257IPR004827Basic-leucine zipper domain
PfamPF001703.5E-10249IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.8E-9349No hitNo description
PfamPF124983.7E-2364121IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 142 aa     Download sequence    Send to blast
MMLSNRESAR RSRRRKQAHL TELETQVSQV RVENSSLLKR LTDISQKYNE AAVDNRVLKA  60
DVETLRAKVK MAEETVKRVT GLNPLFQAMS EISTVMMPSF TSSPFDSSAD AAVPEHDDLN  120
YPAPENGHMP NHDCRMQNAR G*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1916RRSRRRKQ
21116SRRRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.32980.0callus| cell culture| floral bud| flower| fruit| leaf| seed| stem
Functional Description ? help Back to Top
Source Description
UniProtBinds to the G-box-like motif (5'-ACGTGGC-3') of the chalcone synthase (CHS) gene promoter. G-box and G-box-like motifs are defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc08g022080.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0144280.0Lycopersicon esculentum clone 133746F, mRNA sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010324786.12e-98light-inducible protein CPRF2 isoform X2
SwissprotQ990902e-52CPRF2_PETCR; Light-inducible protein CPRF2
TrEMBLA0A3Q7HJU38e-94A0A3Q7HJU3_SOLLC; Uncharacterized protein
STRINGSolyc08g022080.2.11e-101(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29342444
Representative plantOGRP18391639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28770.13e-40bZIP family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Weisshaar B,Armstrong GA,Block A,da Costa e Silva O,Hahlbrock K
    Light-inducible and constitutively expressed DNA-binding proteins recognizing a plant promoter element with functional relevance in light responsiveness.
    EMBO J., 1991. 10(7): p. 1777-86
    [PMID:2050115]