PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc08g013900.2.1
Common NameLOC101246738
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Nin-like
Protein Properties Length: 962aa    MW: 106150 Da    PI: 5.351
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc08g013900.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK89.13.6e-28556607152
              RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         aek++sl++l++yFs+++k+AA+++gvc+T+LKriCRqyGI+RWP+Rki+++
  Solyc08g013900.2.1 556 AEKHVSLSVLQQYFSGSLKNAAQSIGVCPTTLKRICRQYGISRWPSRKISKV 607
                         5899*********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.768539627IPR003035RWP-RK domain
PfamPF020423.1E-24560607IPR003035RWP-RK domain
SuperFamilySSF542772.16E-19853946No hitNo description
Gene3DG3DSA:3.10.20.2402.7E-22858940No hitNo description
PROSITE profilePS5174518.934861943IPR000270PB1 domain
SMARTSM006661.2E-19861943IPR000270PB1 domain
PfamPF005641.8E-15862942IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 962 aa     Download sequence    Send to blast
MENGIGFWAS PRCSYIDDNV MEIMNLDTCA GIEQIFASYP TFSPINPMSI DYAPFEEQNT  60
ETFPCEGVNL MFQQNDDQFC FVESSEEADL VVETGMGKNS SKQNYVTHIV EKCVIPKSPC  120
QSLAERMLKA LELFKKSSGE GILAQVWVPM KSGDQYILST YEQPFLLDQV LSGYREVSRK  180
FTFDLEMKPG SCPGLPGRVF TSRIPEWTSN VMYYKEAEYL RVQYAVDHEV RGSIALPILE  240
DEEYDTLCCA VLELVTVKER PNFDLETSHV CQALQAVNLR STTPTQFSSQ SLSKNQRAAL  300
AEVKDVLRAV CHAHRLPLAL TWIPRSRGGG GDEIRAHARE SIASLDEKSV LCVENTACYV  360
SDKEMQGFLH ACMGHDLEEG QGIVGKSLQS NHPFFYPDVK EYHINEYPLV HHARKFGLNA  420
AVAIRLRSIL TGDDDYVLEF FLPVDMEGST EQQLLLNNLS RTMQRICRSL RTLSDAELIG  480
EGGEKCGLQS ESVLSPPPID LSRKSSQQSL LNSTLDLSKA PIDVCDSERA GIEANISHKQ  540
TPSVSRKRTE KKRSAAEKHV SLSVLQQYFS GSLKNAAQSI GVCPTTLKRI CRQYGISRWP  600
SRKISKVNRS LVKIRTVLQS VQGIEGGLKF DTVTGGIVAA TSILQDFDSQ KSMLSPCKDV  660
SIKSSEFLFQ DAVSALQTSC IDNHDSLVKM EEDLNVDGNQ LPESSHFGPS SFRVGDKPNS  720
LLSGVCHGSK LAALDRRSSL PANPDTMPRT SSGNVSLDSF HTKGGWRSCG LNTSNLKLDN  780
SGCHFISLCP DSMAKTDDIE EKMKGSIEVD GDDGVMEHHK VSSSGVTDLS NTSRSTMNGS  840
SSSSHSSGER KHTTAEDGGS QITVKASYVK DKIRFKFEPS AGCFQLYEEV AKRFKLQIGT  900
FQLHYLDDEE EWVMLVNDAD LNECLEILDI LGTRNVKFLV QDVSGTVGSS GSSNCFLTNG  960
S*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc08g013900.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004244743.10.0protein NLP9-like
SwissprotO228640.0NLP8_ARATH; Protein NLP8
TrEMBLA0A3Q7HLJ00.0A0A3Q7HLJ0_SOLLC; Uncharacterized protein
STRINGSolyc08g013900.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA39812445
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59580.20.0Nin-like family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Yan D, et al.
    NIN-like protein 8 is a master regulator of nitrate-promoted seed germination in Arabidopsis.
    Nat Commun, 2016. 7: p. 13179
    [PMID:27731416]