PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc08g008410.2.1
Common NameLOC101261639
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Nin-like
Protein Properties Length: 1009aa    MW: 109784 Da    PI: 5.9347
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc08g008410.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.43.3e-29601652152
              RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         aek+isle+l++yF++++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  Solyc08g008410.2.1 601 AEKTISLEVLQQYFAGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 652
                         589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.643589672IPR003035RWP-RK domain
PfamPF020423.4E-26604652IPR003035RWP-RK domain
SuperFamilySSF542773.27E-20912998No hitNo description
Gene3DG3DSA:3.10.20.2401.2E-21913994No hitNo description
SMARTSM006662.3E-23913995IPR000270PB1 domain
PROSITE profilePS5174521.745913995IPR000270PB1 domain
PfamPF005641.2E-16914994IPR000270PB1 domain
CDDcd064071.20E-31914994No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1009 aa     Download sequence    Send to blast
MSEPGGGMTQ NHLPKSKELT PATVTERESM MMDLDFDIDA SWSFDQIFAA AAAVSSNPAS  60
PFLPCSPLWA FPDDNDEKPA GNGLSGALRI SGHPRFVAYT GDLEATTETI SVNTDKGRLT  120
SPISGLLPGD NPEGSCIIKE RMTQALRYLK ETSGERVLAQ VWAPVKEAGR SVLTTSGQPF  180
VLDPECNGLH QYRTVSLMYM FAADGETDGV LGLPGRVFRL KLPEWTPNVQ YYSSKEFPRL  240
DHALNYNVRG TLALPVFEPS GRSCVGVLEL IMTSQKINYA AEVDKVCKAL EAVNLKSSDI  300
LDHPNTQVYV MGYMNQICNE GRQNALVDIL EILTAVCETY KLPLAQTWVP CRHRSVLADG  360
GGLRKSCSSF DGSCMGQICM STTDVAFYVV DAHMWGFRDA CAEHHLQRGQ GVAGRAYASR  420
KSCYCEDITQ FCKTEYPLVH YARMFGLTSC FAICLRSSHT ANDDYILEFF LPPNSGDYSD  480
QPALLNSLLL TMKQHFRSLS IASGEELEHD WGSVEIIQAS MEEKIDAKPE SVPTAKTSPQ  540
LTSLPNGWVH LDPVGEQQSA VGSNVSKGAR STSGTGEAPN NVSNSDNKTS GKKSERKRGK  600
AEKTISLEVL QQYFAGSLKD AAKSLGVCPT TMKRICRQHG ISRWPSRKIN KVNRSLSKLK  660
CVIESVQGAE GAFTLTSLAP NSLPAAVSSI SWPAGANVSN LPSSPSSKPS VFPEEKNEFF  720
HHGTPESHIE AEPSNQMLGG RVARKEEFTP MQNGFLHAEG THKSRTGSVS REESAGTPTS  780
HGSCQGSPCA GNGFSPQNEL VNSPAHESCM KVGGSLEAAR QTTAEINLSS AFLMPQPIIP  840
KHTQEPFGGM LVEDAGSSHD LRNLCSPRDA LVDERVPDYN LTNPPFSDAI AKDPVYVPPD  900
TIQQYSAWPE VTSVTIKATY KEDIIRFRLC LSSGIVKLKE EVAKRLKLEL GTFYIKYLDD  960
DLEFVPISCD ADLQECVDIS RSSGSSIVRL LIHDIMSNLG SSCESSGK*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves, flowers and siliques. Detected in root hairs, emerging secondary roots, vascular tissues, leaf parenchyma cells and stomata. {ECO:0000269|PubMed:18826430}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in regulation of nitrate assimilation and in transduction of the nitrate signal. {ECO:0000269|PubMed:18826430}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc08g008410.2.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not regulated by the N source or by nitrate. {ECO:0000269|PubMed:18826430}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004244640.10.0protein NLP6-like isoform X1
SwissprotQ84TH90.0NLP7_ARATH; Protein NLP7
TrEMBLA0A3Q7HL320.0A0A3Q7HL32_SOLLC; Uncharacterized protein
STRINGSolyc08g008410.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52232239
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Xu N, et al.
    The Arabidopsis NRG2 Protein Mediates Nitrate Signaling and Interacts with and Regulates Key Nitrate Regulators.
    Plant Cell, 2016. 28(2): p. 485-504
    [PMID:26744214]
  3. Karve R,Suárez-Román F,Iyer-Pascuzzi AS
    The Transcription Factor NIN-LIKE PROTEIN7 Controls Border-Like Cell Release.
    Plant Physiol., 2016. 171(3): p. 2101-11
    [PMID:27221617]
  4. Yu LH, et al.
    Overexpression of Arabidopsis NLP7 improves plant growth under both nitrogen-limiting and -sufficient conditions by enhancing nitrogen and carbon assimilation.
    Sci Rep, 2016. 6: p. 27795
    [PMID:27293103]
  5. Menz J,Li Z,Schulze WX,Ludewig U
    Early nitrogen-deprivation responses in Arabidopsis roots reveal distinct differences on transcriptome and (phospho-) proteome levels between nitrate and ammonium nutrition.
    Plant J., 2016. 88(5): p. 717-734
    [PMID:27419465]
  6. Yan D, et al.
    NIN-like protein 8 is a master regulator of nitrate-promoted seed germination in Arabidopsis.
    Nat Commun, 2016. 7: p. 13179
    [PMID:27731416]
  7. Guan P, et al.
    Interacting TCP and NLP transcription factors control plant responses to nitrate availability.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(9): p. 2419-2424
    [PMID:28202720]
  8. Liu KH, et al.
    Discovery of nitrate-CPK-NLP signalling in central nutrient-growth networks.
    Nature, 2017. 545(7654): p. 311-316
    [PMID:28489820]
  9. Li Z, et al.
    The Arabidopsis CPSF30-L gene plays an essential role in nitrate signaling and regulates the nitrate transceptor gene NRT1.1.
    New Phytol., 2017. 216(4): p. 1205-1222
    [PMID:28850721]
  10. Cao H, et al.
    Overexpression of the Maize ZmNLP6 and ZmNLP8 Can Complement the Arabidopsis Nitrate Regulatory Mutant nlp7 by Restoring Nitrate Signaling and Assimilation.
    Front Plant Sci, 2017. 8: p. 1703
    [PMID:29051766]
  11. Konishi N,Okubo T,Yamaya T,Hayakawa T,Minamisawa K
    Nitrate Supply-Dependent Shifts in Communities of Root-Associated Bacteria in Arabidopsis.
    Microbes Environ., 2017. 32(4): p. 314-323
    [PMID:29187692]
  12. Karve RA,Iyer-Pascuzzi AS
    Further insights into the role of NIN-LIKE PROTEIN 7 (NLP7) in root cap cell release.
    Plant Signal Behav, 2018. 13(1): p. e1414122
    [PMID:29215953]
  13. Zhao L, et al.
    The Arabidopsis NLP7 gene regulates nitrate signaling via NRT1.1-dependent pathway in the presence of ammonium.
    Sci Rep, 2018. 8(1): p. 1487
    [PMID:29367694]