PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc08g008380.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ARF
Protein Properties Length: 684aa    MW: 76145.7 Da    PI: 5.9306
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc08g008380.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.41.4e-23131231198
                         EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkl 84 
                         f+kvlt sd++++g +++ +k+a+e+       +   +  ++l+ +d++g +W +k+i+r++++r++lt+GW+ Fv++++L +gD++vF +
  Solyc08g008380.2.1 131 FCKVLTASDTSTHGGFSILRKHANEClppldmtQ--ATPAQELVAKDLHGFEWHFKHIFRGQPRRHLLTTGWSTFVSSKRLVTGDSFVFLR 219
                         99****************************9544..444559************************************************5 PP

                         -SSSEE..EEEEE- CS
                  B3  85 dgrsefelvvkvfr 98 
                         +   ++e +++++r
  Solyc08g008380.2.1 220 S--GKGEVRIGIRR 231
                         4..68888999987 PP

2Auxin_resp103.72.3e-34257336183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         a+ha++t+++F v+Y+Pr+  s+F++ ++k+++a+k+++svGmRfkm+fe+e+ +e+r++Gt+vgv+d ++++W++SkWrsLk
  Solyc08g008380.2.1 257 ASHAVTTQTMFVVYYKPRT--SQFIIGLNKYLEAVKHRYSVGMRFKMKFEGEEIPEKRFTGTIVGVED-SSSQWKDSKWRSLK 336
                         789***************6..9**********************************************.555*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019368.37E-40121260IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.108.9E-41123246IPR015300DNA-binding pseudobarrel domain
CDDcd100171.10E-19129231No hitNo description
SMARTSM010193.5E-21131233IPR003340B3 DNA binding domain
PROSITE profilePS5086312.055131233IPR003340B3 DNA binding domain
PfamPF023621.2E-21131231IPR003340B3 DNA binding domain
PfamPF065071.2E-32257336IPR010525Auxin response factor
PfamPF023094.4E-6560614IPR033389AUX/IAA domain
SuperFamilySSF542771.47E-11572654No hitNo description
PROSITE profilePS5174524.419578659IPR000270PB1 domain
PfamPF023095.9E-6623662IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 684 aa     Download sequence    Send to blast
MENQGSFMSN QQHQQHNFLA EGEDELCQEL WRLCAGPLVD VPKNEERVYY FPQGHMEQLE  60
ASTNQELNQS IPLFNLQPKI LCRVLHIQLL AEQDSDEVYA QIALLPEADQ VEPTSPDLSL  120
PEPPRPKVHF FCKVLTASDT STHGGFSILR KHANECLPPL DMTQATPAQE LVAKDLHGFE  180
WHFKHIFRGQ PRRHLLTTGW STFVSSKRLV TGDSFVFLRS GKGEVRIGIR RLARQPSSMP  240
QSVISSQSMH LGVLATASHA VTTQTMFVVY YKPRTSQFII GLNKYLEAVK HRYSVGMRFK  300
MKFEGEEIPE KRFTGTIVGV EDSSSQWKDS KWRSLKVQWD EPASVPRPDR VSPWDIEPFV  360
ASVATPLVPP MGVKNKRHRA HNEPKSSEPV PAAALAAWIP SAQFNPVIEG QSSDNPFSLH  420
TSQTNSTATN STFKARVDGI WSASKVNASL NMLLDETEAS KSASPRPAFP SFASSQFGKQ  480
NDLLLPSLDD ERKCGTITSC RLFGIDLKCP SFGSVNENPP LEPANNSDGS AEGCSGNLTS  540
AGDSEDNSGL SRDSEDQKQE QLNPPPKEVH IKQVSSTRTR TKVQMQGVAV GRAVDLTKLN  600
GYDELLRELE ELFDIQEELH ARNKWEIVFT DDEGDMMLMG DYPWSEFCNI AKRIFICSSQ  660
DMKSFSAGTK SPSCLESETT AST*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1722435917355Auxin response factor 1
4ldw_A1e-1722435917355Auxin response factor 1
4ldw_B1e-1722435917355Auxin response factor 1
4ldx_A1e-1722435917355Auxin response factor 1
4ldx_B1e-1722435917355Auxin response factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.256040.0fruit| root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the whole plant. {ECO:0000269|PubMed:10476078}.
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc08g008380.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM5651270.0Solanum lycopersicum auxin response factor 12 (ARF12) mRNA, complete cds
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019070562.10.0auxin response factor 12 isoform X2
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A3Q7HIF40.0A0A3Q7HIF4_SOLLC; Auxin response factor
STRINGSolyc08g008380.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23472450
Representative plantOGRP5501582
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.11e-174auxin response factor 9
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Wu J, et al.
    Identification, isolation and expression analysis of auxin response factor (ARF) genes in Solanum lycopersicum.
    Plant Cell Rep., 2011. 30(11): p. 2059-73
    [PMID:21735233]