PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc08g007270.2.1
Common NameLOC101262232
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 276aa    MW: 31459.8 Da    PI: 8.4969
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc08g007270.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.74.6e-19112166256
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         rk+ ++tk+q  +Lee F+++++++ ++++ LAk+lgL  rqV vWFqNrRa+ k
  Solyc08g007270.2.1 112 RKKLRLTKDQSIVLEESFKEHNTLNPKQKQALAKRLGLRPRQVEVWFQNRRARTK 166
                         788899***********************************************98 PP

2HD-ZIP_I/II127.27e-41112201191
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         +kk+rl+k+q+ +LEesF+e+++L+p++K++la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e Lkr++++l+een+rL+kev+eLr +l
  Solyc08g007270.2.1 112 RKKLRLTKDQSIVLEESFKEHNTLNPKQKQALAKRLGLRPRQVEVWFQNRRARTKLKQTEVDCELLKRCCENLTEENRRLQKEVQELR-AL 201
                         69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046183.2E-16184IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466891.5E-18104169IPR009057Homeodomain-like
PROSITE profilePS5007117.524108168IPR001356Homeobox domain
SMARTSM003894.6E-16110172IPR001356Homeobox domain
CDDcd000861.93E-14112169No hitNo description
Gene3DG3DSA:1.10.10.606.8E-18112166IPR009057Homeodomain-like
PfamPF000461.8E-16112166IPR001356Homeobox domain
PRINTSPR000311.3E-5139148IPR000047Helix-turn-helix motif
PROSITE patternPS000270143166IPR017970Homeobox, conserved site
PRINTSPR000311.3E-5148164IPR000047Helix-turn-helix motif
PfamPF021834.8E-11168202IPR003106Leucine zipper, homeobox-associated
SMARTSM003404.2E-26168211IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MLENQDLRLS LSLSFSENKT TNPLQLNSWI GSFPSSDRNL EKCRTFLKGI DVNIIPTNTE  60
EEVGVSSPNS SISSLSGNKR NEREIINCCD ELEIERECSR SISDEEDGET SRKKLRLTKD  120
QSIVLEESFK EHNTLNPKQK QALAKRLGLR PRQVEVWFQN RRARTKLKQT EVDCELLKRC  180
CENLTEENRR LQKEVQELRA LKLSPQLYMQ MTPPTTLTMC PSCERVAGPS AMSGPASIDI  240
RTNQMVLARQ RPVPFNLWTA SPVPHRPINT LHPRS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1110116SRKKLRL
2160168RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that plays a role in auxin-mediated morphogenesis. Negatively regulates lateral root elongation. {ECO:0000269|PubMed:12492842}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc08g007270.2.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By indole-3-acetic acid (IAA). {ECO:0000269|PubMed:12492842}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0092880.0Solanum lycopersicum genomic DNA, chromosome 8, clone: C08HBa0270A17, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004244560.10.0homeobox-leucine zipper protein HAT4
SwissprotP466011e-92HAT2_ARATH; Homeobox-leucine zipper protein HAT2
TrEMBLA0A3Q7HKK11e-178A0A3Q7HKK1_SOLLC; Uncharacterized protein
STRINGSolyc08g007270.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.12e-90homeobox protein 2
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Zou LJ, et al.
    Role of Transcription Factor HAT1 in Modulating Arabidopsis thaliana Response to Cucumber mosaic virus.
    Plant Cell Physiol., 2016. 57(9): p. 1879-89
    [PMID:27328697]