PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc08g007190.2.1
Common NameLOC101260660
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GATA
Protein Properties Length: 543aa    MW: 60329.6 Da    PI: 7.4817
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc08g007190.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA49.46.2e-16741135
                GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                        C +Cg+t+TplWR+gp  ++ LCnaCG ++r kg+
  Solyc08g007190.2.1  7 CYHCGVTSTPLWRNGPPEKPILCNACGSRWRTKGT 41
                        ****************66666***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004014.4E-10153IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.04E-11446No hitNo description
CDDcd002022.73E-16655No hitNo description
PROSITE patternPS003440732IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.8E-12741IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.2740IPR000679Zinc finger, GATA-type
PfamPF003209.9E-14741IPR000679Zinc finger, GATA-type
PfamPF139192.8E-9282363IPR028020ASX homology domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 543 aa     Download sequence    Send to blast
MGKEGPCYHC GVTSTPLWRN GPPEKPILCN ACGSRWRTKG TLANYTPLHA RAEPCDFEEH  60
RVSRFKNISM KNKEAKILKR KQSHHDAEVG TPDYSLGFRK VLDEDTSNRS SSGSAISNSE  120
SCAQFGSAEA SDLTGPAQSN IWDSTVPSRK RTCFNRPKPS SVEKLTKDLY TILHEQQSSY  180
LSASSEEELL FESDKPMVSV EIGHGSVLMR YPSTIGREEE SEASSLSVDN KHRSVSDAYS  240
RLTTPPVNIS KGVNSPNMGT ERIKKPTGPA IEQDQIKRNK DHLEKLQILG HHNSPLRYLD  300
LKDVLNYEEF TTHLSSDEQQ QLLKYLPPVD SFAPPDSLRS VFESSQFEEN LCSFQKLLAE  360
GVFDNSFPGV TLEDCRNLKR FILCYLTKSK WVQQYNLLKD TKCKNSSSGS EVAGEPNAVG  420
TCHSANVKKP REGQYPKCSG AKTTMKSPKR VVMKSIYEQK ELVDNDGSCF SPRSSFALPS  480
ENSSLVLDSL RSANENSHQD LLLDVPSNSY CPQAELLLPT SSFTTQASTS SSSMYPPHFI  540
RP*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc08g007190.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004244556.10.0GATA transcription factor 26-like
SwissprotQ8W4H11e-146GAT26_ARATH; GATA transcription factor 26
TrEMBLA0A3Q7HK810.0A0A3Q7HK81_SOLLC; Uncharacterized protein
STRINGSolyc08g007190.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20892462
Representative plantOGRP27491530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17570.31e-138GATA transcription factor 26
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]