PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc08g006530.2.1
Common NameLOC101268413
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family CO-like
Protein Properties Length: 350aa    MW: 38658.8 Da    PI: 5.1512
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc08g006530.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.83.9e-071043336
            zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg 36
                        +++C+ ++  + + fC+ +  +lC +C +++H  
  Solyc08g006530.2.1 10 AKRCDACKATPSTVFCKADMAFLCLTCDSKIHAA 43
                        579*****************************54 PP

2zf-B_box26.21.6e-085398342
            zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                         ++C+ +e+ +++  C+ +   lC +C + +H+       H+++p+
  Solyc08g006530.2.1 53 VWVCEVCEHAPASVTCKADAAALCTTCDQDIHSAnplarrHERIPV 98
                        689*****************************66889999999885 PP

3CCT67.73.1e-23285328144
                 CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                         R+a++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Solyc08g006530.2.1 285 RKARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 328
                         9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.855855IPR000315B-box-type zinc finger
SMARTSM003368.5E-11855IPR000315B-box-type zinc finger
CDDcd000211.98E-71255No hitNo description
PROSITE profilePS5011910.8655198IPR000315B-box-type zinc finger
PfamPF006431.2E-65398IPR000315B-box-type zinc finger
CDDcd000218.41E-85498No hitNo description
SMARTSM003365.7E-105698IPR000315B-box-type zinc finger
PfamPF062032.0E-17285327IPR010402CCT domain
PROSITE profilePS5101716.708285327IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MVAESWSTTA KRCDACKATP STVFCKADMA FLCLTCDSKI HAANKLASRH ARVWVCEVCE  60
HAPASVTCKA DAAALCTTCD QDIHSANPLA RRHERIPVVP FYDSASASSS RGAAADGNDD  120
PQQHDDDTEE EEAEAESWLL QAPSTNNNTQ GIEYKSVEYL FSDVDPYVEM DIIADQKPSN  180
DIAQLHNQEE YKEDCVVPHV QNNKNDIQLQ GPVVDGYPTY EIDFSGGSKP FMYNFTSQSI  240
SQSVSSSSME VGVVPDHNTM TDVSNTFVRN SAIDGLPNPV SSLDRKARVL RYREKRKNRK  300
FEKTIRYASR KAYAETRPRI KGRFAKRTEN EVGDSLVASD ASYGVVPSF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc08g006530.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004244497.10.0zinc finger protein CONSTANS-LIKE 4-like
SwissprotQ940T93e-96COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLA0A3Q7HHB60.0A0A3Q7HHB6_SOLLC; Uncharacterized protein
STRINGSolyc08g006530.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.14e-90CONSTANS-like 4
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]