PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc08g006280.1.1
Common NameLOC104648601
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family B3
Protein Properties Length: 566aa    MW: 65488.6 Da    PI: 9.6825
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc08g006280.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B355.31.2e-17138223390
                         EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
                  B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                           +++++++k g l+lp +f++++++ ++ + +l+++de+ rsW+++l  + +s+r+vl +GW eF +an++kegD v+F+ ++++e+
  Solyc08g006280.1.1 138 VCTIRPYSFKYGYLCLPLDFVTKNNLRHKIG-DLIIRDEKQRSWNLRL-NSFSSKRFVLNGGWPEFSNANDIKEGDEVMFEIVSNEEK 223
                         567899******************9998887.9***************.4667788*************************9887555 PP

2B336.96.3e-12458537586
                         -..-HHHHTT-EE--HHH.HTT..---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                  B3   5 ltpsdvlksgrlvlpkkfaeeh..ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                          ++++ l ++ l +p kfa ++       ++ +l+++d + rsW+v+l  r + + +++++GWk+  +   +kegD ++F+ + 
  Solyc08g006280.1.1 458 NVNPYCLVTDTLLIPEKFALANdlF--RIKKCDLIIRDDNDRSWNVTL--REHNNYVFIKDGWKKIRDTYYIKEGDQIMFEIVT 537
                         56788888999***********663..445558***************..*******************************664 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.35E-11899IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.3E-11899IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508638.1061099IPR003340B3 DNA binding domain
SMARTSM010190.00121399IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.7E-18133231IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.53E-17134232IPR015300DNA-binding pseudobarrel domain
CDDcd100171.87E-11135216No hitNo description
SMARTSM010194.5E-13136231IPR003340B3 DNA binding domain
PROSITE profilePS5086314.015136231IPR003340B3 DNA binding domain
PfamPF023622.0E-15137224IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.9E-12449541IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.87E-13449544IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.955454549IPR003340B3 DNA binding domain
SMARTSM010197.8E-7455550IPR003340B3 DNA binding domain
PfamPF023621.6E-9458540IPR003340B3 DNA binding domain
CDDcd100177.26E-9466534No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 566 aa     Download sequence    Send to blast
MATMKGYSEK PSFLMFISPS LKQGFTFPDE FLKHLKGHDQ YEHAILRWAN KNWPVKLNGV  60
RLEDGLEKFV EQNNLEEGEI LSIEYEGNMK FEAIRFDPSK QCEILEVQPR APKVVKSSDE  120
SKSKGAATQK HLGHPYFVCT IRPYSFKYGY LCLPLDFVTK NNLRHKIGDL IIRDEKQRSW  180
NLRLNSFSSK RFVLNGGWPE FSNANDIKEG DEVMFEIVSN EEKQIWQFKK KASNNVKSSL  240
LVEPPKVKSR KPSQRRDIKA MMVDVVHMPV DKLIHKNKSS FVAKTPKSKS RELRQRQELE  300
DQTLKAFPHK SFDESNHNIK SAPLAKTPKP KSRRPAERDD FEDRSLEAVT HKPNEPSKLK  360
LGGLHQRQEF EEGTFEAATH KSLDKPTHKK LKSTPLAEPS QSKPRELPQK QNFEDQTTNV  420
ATQKPHDESN YYTTSSKEAT PLKDDPHKSS DNPCILINVN PYCLVTDTLL IPEKFALAND  480
LFRIKKCDLI IRDDNDRSWN VTLREHNNYV FIKDGWKKIR DTYYIKEGDQ IMFEIVTGGD  540
KPIWKFHGKI SKEFVKMIQQ NGLEQ*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc08g006280.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0092831e-130Solanum lycopersicum genomic DNA, chromosome 8, clone: C08HBa0216M19, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010324533.10.0uncharacterized protein LOC104648601
TrEMBLA0A3Q7HH760.0A0A3Q7HH76_SOLLC; Uncharacterized protein
STRINGSolyc08g006280.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA2098733
Representative plantOGRP2682231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.14e-19B3 family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]