PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc08g006260.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family B3
Protein Properties Length: 252aa    MW: 29393.4 Da    PI: 6.1745
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc08g006260.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B343.94.2e-141093197
                        EEEE-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
                  B3  1 ffkvltpsdvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92
                        ffk l     +k++ l +p  f+ ++ +g +e++    l  + g++W vkl  ++++    l++GW +F+++++Lk gD+++F+++g+ ef  
  Solyc08g006260.1.1 10 FFKPL--LPGFKNS-LKIPDGFL-KYlEGCEEKG--RALLKKGGKKWVVKL--NGQK----LEEGWGQFAEEHDLKLGDMLIFRHEGDLEF-- 88
                        66777..6677776.********.5557776665..677799*********..8888....***********************8886555.. PP

                        EEEEE CS
                  B3 93 vvkvf 97
                         v+vf
  Solyc08g006260.1.1 89 DVTVF 93
                        77776 PP

2B3491.1e-15141222589
                         -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
                  B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                         +++++ l++g l++p kfa+++g+ + ++  l+++de+ rsW++++    + +++++++ W+eF  an++k gD ++F+++++ e
  Solyc08g006260.1.1 141 TVKPYCLRNGYLRVPCKFAKANGLTN-KECGLIIRDERQRSWNLRI--YTSCSQVYIGGRWSEFRAANDIKKGDQIMFEVVSNGE 222
                         578999****************7664.3346999************..88888999***********************887633 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.105.8E-19497IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.28796IPR003340B3 DNA binding domain
CDDcd100174.73E-10894No hitNo description
SuperFamilySSF1019361.12E-188102IPR015300DNA-binding pseudobarrel domain
SMARTSM010193.5E-131096IPR003340B3 DNA binding domain
PfamPF023621.7E-101792IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.108.3E-17135224IPR015300DNA-binding pseudobarrel domain
SMARTSM010198.5E-8137231IPR003340B3 DNA binding domain
SuperFamilySSF1019367.06E-17137226IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.743137231IPR003340B3 DNA binding domain
PfamPF023624.7E-14140223IPR003340B3 DNA binding domain
CDDcd100177.29E-13143216No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MEVTSVQPHF FKPLLPGFKN SLKIPDGFLK YLEGCEEKGR ALLKKGGKKW VVKLNGQKLE  60
EGWGQFAEEH DLKLGDMLIF RHEGDLEFDV TVFNLNHCDR EYAEYEEEEE EVRTVEETST  120
NFEFKEGSTH IPFGQSQFIC TVKPYCLRNG YLRVPCKFAK ANGLTNKECG LIIRDERQRS  180
WNLRIYTSCS QVYIGGRWSE FRAANDIKKG DQIMFEVVSN GEQPIWNFHG WQRITTDTIW  240
CFFVKELWLH L*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.167890.0fruit| leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc08g006260.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0092831e-175Solanum lycopersicum genomic DNA, chromosome 8, clone: C08HBa0216M19, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010324528.11e-139B3 domain-containing protein REM14 isoform X2
TrEMBLA0A3Q7HH761e-135A0A3Q7HH76_SOLLC; Uncharacterized protein
STRINGSolyc08g006260.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32215171
Representative plantOGRP2682231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.14e-31B3 family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]