PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc08g006240.1.1
Common NameLOC101252102
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family B3
Protein Properties Length: 505aa    MW: 58982 Da    PI: 9.786
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc08g006240.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3469.6e-151195599
                        -..-HHHHTT-EE--HHH.HTT..---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
                  B3  5 ltpsdvlksgrlvlpkkfaeeh..ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95
                        l+p + + ++ l +p  f+ ++  g++  ++ +  +  + g++W vk+  ++ +    l++GWk+F+++n+L  gD++vF+++g++ef   v+
  Solyc08g006240.1.1 11 LKPIHKGFKHGLKIPIGFL-KYlkGHD--QH-EHAILRSAGKTWLVKV--NGWR----LEEGWKKFANENDLHLGDMLVFRHEGDMEF--EVS 91
                        55667777888********.6655444..33.4555667*********..6666....9***********************999999..999 PP

                        EE-S CS
                  B3 96 vfrk 99
                        +f++
  Solyc08g006240.1.1 92 IFDS 95
                        9986 PP

2B353.73.7e-17158241592
                         -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
                  B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                          ++++  +++ l+lpk+fa e+++ + ++ +++++de+ rsW+++l    +++r+ l +GW+eF  an+L++gD ++F+++ + ++++
  Solyc08g006240.1.1 158 IVKPYCITHSYLRLPKHFAMENDIFN-KKCDVIIRDERQRSWKLRL--ATHDCRVHLLGGWREFRVANDLNVGDYMMFEVIAN-GEKP 241
                         5678999999************4432.3348***************..99999977888********************9875.3334 PP

3B351.51.9e-16281363692
                         ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
                  B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                         ++++ lk++  +lp+ fa+++g+++++   l+++de+ rsW++++  + ++ +++++kGW++F  +n+LkegD ++F+++++ ++++
  Solyc08g006240.1.1 281 VRPYCLKRNYYRLPRGFARANGLINTKC-GLVIRDERQRSWNLRI--DTYGYGVYIAKGWSKFRVENDLKEGDRMMFEVVSN-GEKP 363
                         6789999**************8887664.8999************..*******************************8874.4444 PP

4B346.18.7e-15391473689
                         ..-HHHHTT-EE--HHH.HTT---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SE CS
                  B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.se 89 
                         ++++ l ++ l++p k a ++ + +++  +l+++d ++ rsW+vkl  r  ++++ +++GW+ F +an LkegD ++F+++++ ++
  Solyc08g006240.1.1 391 IRPYCLVNDFLYIPTKIAHAYRLTNKKC-DLVIRDdRRERSWNVKL--RSFGNSVCIKGGWRVFRDANCLKEGDCIMFEVVSNgEN 473
                         6678888999***********7665444.6777775999*******..999999*************************8876343 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.5E-20398IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.16E-19498IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.887796IPR003340B3 DNA binding domain
SMARTSM010192.6E-131096IPR003340B3 DNA binding domain
PfamPF023623.4E-121195IPR003340B3 DNA binding domain
CDDcd100173.21E-141194No hitNo description
Gene3DG3DSA:2.40.330.101.4E-17152246IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.85E-19153248IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.957154248IPR003340B3 DNA binding domain
SMARTSM010191.7E-14155248IPR003340B3 DNA binding domain
PfamPF023627.8E-15159242IPR003340B3 DNA binding domain
CDDcd100175.05E-12160233No hitNo description
Gene3DG3DSA:2.40.330.109.8E-16273364IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.57E-15276367IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.421276370IPR003340B3 DNA binding domain
SMARTSM010191.3E-13276371IPR003340B3 DNA binding domain
PfamPF023627.4E-14281364IPR003340B3 DNA binding domain
CDDcd100172.57E-9292355No hitNo description
Gene3DG3DSA:2.40.330.102.4E-16384472IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.12E-15385477IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.688386481IPR003340B3 DNA binding domain
SMARTSM010193.2E-11387481IPR003340B3 DNA binding domain
PfamPF023624.9E-13391474IPR003340B3 DNA binding domain
CDDcd100179.75E-11399466No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 505 aa     Download sequence    Send to blast
MKIPPKKPQF LKPIHKGFKH GLKIPIGFLK YLKGHDQHEH AILRSAGKTW LVKVNGWRLE  60
EGWKKFANEN DLHLGDMLVF RHEGDMEFEV SIFDSSHCDR EYAEYLQQEA GFNNVEETCK  120
KFEFKGKSNL CIMSSGEALP YAEAATYNPC SRSHFECIVK PYCITHSYLR LPKHFAMEND  180
IFNKKCDVII RDERQRSWKL RLATHDCRVH LLGGWREFRV ANDLNVGDYM MFEVIANGEK  240
PIWKFRGDKP NANIVSTRKA FPKEEFATCS SFTQSHVECI VRPYCLKRNY YRLPRGFARA  300
NGLINTKCGL VIRDERQRSW NLRIDTYGYG VYIAKGWSKF RVENDLKEGD RMMFEVVSNG  360
EKPIWKFYGT NTNKNKNKNK PFAQSHFVCI IRPYCLVNDF LYIPTKIAHA YRLTNKKCDL  420
VIRDDRRERS WNVKLRSFGN SVCIKGGWRV FRDANCLKEG DCIMFEVVSN GENTTWKYNG  480
KISTKDHKKP IDKDNVKKLV MGKH*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc08g006240.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0092831e-174Solanum lycopersicum genomic DNA, chromosome 8, clone: C08HBa0216M19, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025888361.10.0B3 domain-containing protein REM17-like isoform X1
TrEMBLA0A3Q7HK070.0A0A3Q7HK07_SOLLC; Uncharacterized protein
TrEMBLM1AKH50.0M1AKH5_SOLTU; Uncharacterized protein
STRINGSolyc08g006240.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32215171
Representative plantOGRP2682231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24700.15e-44B3 family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]