PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc08g006230.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family B3
Protein Properties Length: 335aa    MW: 38881.3 Da    PI: 6.7806
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc08g006230.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B344.42.9e-14441191499
                         T-EE--HHH.HTT..---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                  B3  14 grlvlpkkfaeeh..ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                         ++l +p +f+ ++  g++   +++  +  + g++W vk+  ++ +    l++GW++F+++++L  gDf+vFk++g++ef   v++f++
  Solyc08g006230.2.1  44 SILKIPIDFL-KYleGMN---HIKHAILKSMGKKWLVKV--NGWR----LEEGWEKFAEEHDLHLGDFLVFKHEGDMEF--EVSIFDS 119
                         7799******.6655444...456777788*********..6666....9***********************999999..9999986 PP

2B346.56.5e-15164239684
                         ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
                  B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkl 84 
                         +++++ ++g l+lpk+fa ++g+ + ++ +l+++de+ rsW+++l    +++ +   + W++F+  n+Lk gD v+F+ 
  Solyc08g006230.2.1 164 VRPNYISNGYLRLPKHFAIANGLTN-KKCDLIVRDERQRSWNLRL--VAYDSCVRVYGEWSNFCIVNNLKKGDYVTFEI 239
                         567889999************8885.4569***************..455444556677******************95 PP

3B341.32.7e-132513171787
                         E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
                  B3  17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                         +lp +f++++g+ +++  +++l de+ rsW+v l   +++ ++ +++GW +F +ang++ gD+  F+l+++
  Solyc08g006230.2.1 251 YLPMDFVKSNGLMSRS--EMILIDEKQRSWSVWL--GQTGHQFGIKRGWTQFRNANGIQLGDTYKFELTNN 317
                         79********988555..8***************..999999*************************9764 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086312.80231120IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.0E-1740122IPR015300DNA-binding pseudobarrel domain
SMARTSM010193.1E-1240120IPR003340B3 DNA binding domain
SuperFamilySSF1019364.12E-1741122IPR015300DNA-binding pseudobarrel domain
PfamPF023627.3E-1144119IPR003340B3 DNA binding domain
CDDcd100172.94E-1346118No hitNo description
Gene3DG3DSA:2.40.330.108.2E-15157240IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.12E-16158245IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.377159250IPR003340B3 DNA binding domain
SMARTSM010191.8E-8160245IPR003340B3 DNA binding domain
PfamPF023625.7E-13164240IPR003340B3 DNA binding domain
CDDcd100173.22E-14167238No hitNo description
SMARTSM010192.6E-8246331IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.5E-14250331IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.06E-15250333IPR015300DNA-binding pseudobarrel domain
CDDcd100173.73E-10251325No hitNo description
PfamPF023624.0E-11251317IPR003340B3 DNA binding domain
PROSITE profilePS5086311.928252328IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0005634Cellular Componentnucleus
GO:0009941Cellular Componentchloroplast envelope
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MICNLGDLLI FKHEGDMEFE SSSDCDENRF KETSNFSNRF SQVSILKIPI DFLKYLEGMN  60
HIKHAILKSM GKKWLVKVNG WRLEEGWEKF AEEHDLHLGD FLVFKHEGDM EFEVSIFDSS  120
HCDREYTEYL LEGVDNAEET FKKVKFKEAA THNCRGQSHY QCIVRPNYIS NGYLRLPKHF  180
AIANGLTNKK CDLIVRDERQ RSWNLRLVAY DSCVRVYGEW SNFCIVNNLK KGDYVTFEIV  240
PYGEKICKTS YLPMDFVKSN GLMSRSEMIL IDEKQRSWSV WLGQTGHQFG IKRGWTQFRN  300
ANGIQLGDTY KFELTNNGTI PIAHVSILEV KGCE*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc08g006230.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0092831e-171Solanum lycopersicum genomic DNA, chromosome 8, clone: C08HBa0216M19, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025888238.10.0B3 domain-containing protein REM10-like isoform X2
TrEMBLA0A3Q7HK070.0A0A3Q7HK07_SOLLC; Uncharacterized protein
STRINGSolyc08g006230.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32215171
Representative plantOGRP2682231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31690.14e-41B3 family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]