PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc08g006220.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family B3
Protein Properties Length: 247aa    MW: 28600.9 Da    PI: 10.0295
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc08g006220.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B345.91e-1418951199
                        HHTT-EE--HHH.HTT..---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                  B3 11 lksgrlvlpkkfaeeh..ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                         k+ ++ +p  f+ ++  g+++   ++  +  ++g++W vk+  ++ +    l++GWk+F+k+n+L+ gD ++Fk++g++ef   v++f++
  Solyc08g006220.2.1 18 YKH-CIKIPIGFL-KYlkGLNH---IKQAILRSRGKKWLVKV--TGWR----LEEGWKKFAKENDLQLGDLLIFKHEGDMEF--EVSIFDS 95
                        444.599*****9.66665553...44555677*********..5555....99**********************999999..9999986 PP

2B351.91.3e-16154232587
                         -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
                  B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                         +++ +++++++l++p +f++++g+ +++  +++l de+ rsW+v l   +   ++ +++GW +F kangL+egD+  F+l+++
  Solyc08g006220.2.1 154 TIRRYTFTKAILYFPMRFVKSNGLMSRS--EMILVDEKQRSWSVLL--GQMEHHFGIKRGWPQFRKANGLQEGDTYKFELTNN 232
                         4678999***************998555..8***************..88888899***********************9764 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.5E-19498IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.96E-19598IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.985796IPR003340B3 DNA binding domain
CDDcd100172.14E-17894No hitNo description
SMARTSM010192.7E-171096IPR003340B3 DNA binding domain
PfamPF023625.2E-121795IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.6E-18144237IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.08E-18148239IPR015300DNA-binding pseudobarrel domain
CDDcd100171.15E-13149242No hitNo description
PROSITE profilePS5086312.901150243IPR003340B3 DNA binding domain
SMARTSM010195.4E-13151244IPR003340B3 DNA binding domain
PfamPF023626.3E-15154234IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MKVASKKPRF FKPIQPGYKH CIKIPIGFLK YLKGLNHIKQ AILRSRGKKW LVKVTGWRLE  60
EGWKKFAKEN DLQLGDLLIF KHEGDMEFEV SIFDSSHCDR EYAEYLQEEE GNYVDATSKK  120
VEKDLRHKTS DMTTPISQTP ASTSADADPH FISTIRRYTF TKAILYFPMR FVKSNGLMSR  180
SEMILVDEKQ RSWSVLLGQM EHHFGIKRGW PQFRKANGLQ EGDTYKFELT NNGTIPIIHM  240
SKYSGN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc08g006220.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0092831e-170Solanum lycopersicum genomic DNA, chromosome 8, clone: C08HBa0216M19, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025888305.11e-173putative B3 domain-containing protein REM15
TrEMBLA0A3Q7IDZ70.0A0A3Q7IDZ7_SOLLC; Uncharacterized protein
STRINGSolyc08g006220.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32215171
Representative plantOGRP2682231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24700.19e-42B3 family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]