PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc08g006210.1.1
Common NameLOC101251495
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family B3
Protein Properties Length: 402aa    MW: 46314.1 Da    PI: 8.7434
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc08g006210.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B347.33.7e-1519941399
                        TT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                  B3 13 sgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                        ++++++p  f+ ++ +g++    +  l  + +++W+vk+  ++++    l++GW+eFvk+++L+ g +++F+++g++ef   v vf++
  Solyc08g006210.1.1 19 KQQITIPIGFF-KYlKGQE---NEYALLRRASKKWSVKV--NGRR----LEDGWEEFVKDHDLQLGNVLIFRHEGDMEF--EVAVFDS 94
                        56799******.5536664...479999***********..8888....************************999999..8888876 PP

2B355.11.4e-17162248596
                         -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
                  B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                         +++++ l++ +l++pk+fa+e+++ +++  +++++d + rsW++ +    +++ +++++GW eF + + LkegD+++F+ ++ +++++ ++
  Solyc08g006210.1.1 162 TIRPYCLSKYCLCIPKQFAQENSLRNRK-CEIIVRD-EQRSWTFGV--HTNGKNTFIGSGWHEFSRTKCLKEGDILMFEIVS-NGETPIFR 247
                         56788899999***********888655.59**999.679******..88888899***********************887.55557776 PP

                         E CS
                  B3  96 v 96 
                         +
  Solyc08g006210.1.1 248 F 248
                         6 PP

3B346.56.6e-15303387795
                         .-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
                  B3   7 psdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                         ++++l+   l+lp  fa+++g+    +++l+++de+ rsW++ l  +  + ++ ++kGW++F +ang+++gD+  F+l+++ ++ ++v+
  Solyc08g006210.1.1 303 KPYTLRFPVLYLPIAFAKSNGLLD--KRELIIMDEKRRSWSMCL-GQIDKYHFGIKKGWRKFIEANGVQVGDTYKFELINN-GTIPLVH 387
                         55666666799*********8774..458***************.34444458899**********************984.4445555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.104.4E-20397IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.73E-19497IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.562795IPR003340B3 DNA binding domain
CDDcd100172.14E-12893No hitNo description
SMARTSM010198.0E-151095IPR003340B3 DNA binding domain
PfamPF023622.1E-112093IPR003340B3 DNA binding domain
CDDcd100173.78E-15152250No hitNo description
Gene3DG3DSA:2.40.330.105.3E-19156248IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.96E-18157248IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.716158251IPR003340B3 DNA binding domain
SMARTSM010194.9E-15159252IPR003340B3 DNA binding domain
PfamPF023622.7E-15162249IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.2E-18291388IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.31E-19293389IPR015300DNA-binding pseudobarrel domain
CDDcd100173.46E-15296390No hitNo description
PROSITE profilePS5086312.999297391IPR003340B3 DNA binding domain
SMARTSM010196.8E-15298392IPR003340B3 DNA binding domain
PfamPF023623.0E-13304387IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MKIPPKKPHF LKPILPGCKQ QITIPIGFFK YLKGQENEYA LLRRASKKWS VKVNGRRLED  60
GWEEFVKDHD LQLGNVLIFR HEGDMEFEVA VFDSSCCERE YEQGVHVHGG EEEEACIVEE  120
SSKKLKSKEK PKRKVKKSGK GFSNVKAAYK DKHLSRSHFI CTIRPYCLSK YCLCIPKQFA  180
QENSLRNRKC EIIVRDEQRS WTFGVHTNGK NTFIGSGWHE FSRTKCLKEG DILMFEIVSN  240
GETPIFRFHD LRESPFLQDE VKKKDSDAER MSDEDATLET SDVTTPKSQE AADANPHFIS  300
TIKPYTLRFP VLYLPIAFAK SNGLLDKREL IIMDEKRRSW SMCLGQIDKY HFGIKKGWRK  360
FIEANGVQVG DTYKFELINN GTIPLVHFHC KYDDVGDGKG N*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc08g006210.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0092831e-179Solanum lycopersicum genomic DNA, chromosome 8, clone: C08HBa0216M19, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015085028.10.0B3 domain-containing protein REM10-like isoform X1
TrEMBLA0A3Q7HK020.0A0A3Q7HK02_SOLLC; Uncharacterized protein
STRINGSolyc08g006210.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32215171
Representative plantOGRP2682231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24700.18e-49B3 family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]