PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc08g006200.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family B3
Protein Properties Length: 567aa    MW: 65675.8 Da    PI: 7.723
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc08g006200.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B340.55e-1320951499
                        T-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                  B3 14 grlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                        + l +p  f+ ++  g+    ++  l  + g++W vk+  ++++    +++GW++Fv++++L+ g  ++F+++g++ef   v++f++
  Solyc08g006200.1.1 20 DGLNIPIGFM-KYlRGQ--DYIKHALLKSAGKKWLVKV--NGRR----FKEGWRKFVEDHDLQLGYLLIFRHEGDMEF--DVSIFDS 95
                        56999****9.555555..4567899999*********..8887....9***********************999999..9999986 PP

2B348.31.8e-151932661186
                         HHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                  B3  11 lksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                         ++ g l++pk+ a ++g++++++ +l ++de+ rsW+vkl    ++ ++++++GW++F  +  LkegD ++F+ + 
  Solyc08g006200.1.1 193 FSYGYLRIPKHAAFANGHVTNKKYDLLIRDEKQRSWNVKL--HSCQTQTYIGGGWRKFSADCCLKEGDRIIFEIVT 266
                         677899**********************************..999999*************************664 PP

3B344.92e-14327412696
                         ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
                  B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                         ++++  ++ +l +p  fa+e+g++ ++   ++++de+ rsW +kl    +   +++++ W eF++an LkegD v+F++ ++ ++ lv+k+
  Solyc08g006200.1.1 327 ITHSCISKYLLHVPTLFARENGLDRKC--RVKIRDEQQRSWMFKL--YVTAHNIFIGGIWHEFCSANFLKEGDRVMFEMFSK-GEGLVLKF 412
                         66777888899*************777..69999***********..888889*************************7664.33355555 PP

4B355.69.7e-18469548588
                         -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
                  B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                         +++s++ +++ l+lp  f+++ g+ +++  +++l+de+ rsW v+l  +++ +r+v+tkG ++F kang+++gD+  F+l++++
  Solyc08g006200.1.1 469 TIKSNTISRSVLYLPMAFIKSTGLMNRR--KIILTDEKQRSWPVQL--TQRVDRFVITKGFQKFMKANGVQVGDTYKFELIDDR 548
                         67899999**************988555..8***************..9999***************************99753 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.5E-18397IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.35E-18498IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.928796IPR003340B3 DNA binding domain
CDDcd100174.98E-13994No hitNo description
SMARTSM010191.6E-151096IPR003340B3 DNA binding domain
PfamPF023621.1E-91995IPR003340B3 DNA binding domain
SuperFamilySSF1019362.16E-15181275IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.7E-15181275IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.997183281IPR003340B3 DNA binding domain
SMARTSM010192.0E-6184278IPR003340B3 DNA binding domain
PfamPF023624.7E-13190269IPR003340B3 DNA binding domain
CDDcd100173.52E-9194263No hitNo description
Gene3DG3DSA:2.40.330.101.2E-17320412IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.85E-17320412IPR015300DNA-binding pseudobarrel domain
CDDcd100173.14E-12321416No hitNo description
SMARTSM010191.1E-6322416IPR003340B3 DNA binding domain
PROSITE profilePS5086311.603322418IPR003340B3 DNA binding domain
PfamPF023621.5E-12326413IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.0E-21460555IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.14E-20461556IPR015300DNA-binding pseudobarrel domain
CDDcd100175.39E-14464555No hitNo description
PROSITE profilePS5086313.112465558IPR003340B3 DNA binding domain
SMARTSM010191.8E-13466558IPR003340B3 DNA binding domain
PfamPF023621.0E-15468548IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 567 aa     Download sequence    Send to blast
MKIPSKKSHF FKPILTGFMD GLNIPIGFMK YLRGQDYIKH ALLKSAGKKW LVKVNGRRFK  60
EGWRKFVEDH DLQLGYLLIF RHEGDMEFDV SIFDSTHCGR EYVEYLQVEQ EQKQRQQEEE  120
EEEEKEDDDD DEEEEEVEEV VHTTEETSMD FEFKEKSSSS IESSDEASSH SEASTDKSFG  180
HSRFICNITA CCFSYGYLRI PKHAAFANGH VTNKKYDLLI RDEKQRSWNV KLHSCQTQTY  240
IGGGWRKFSA DCCLKEGDRI IFEIVTGGET PIWKFQVVTD AKTPMRKFQE NATESPKPCV  300
MSSNKDLPDV EAAKDMPWSR PHFICTITHS CISKYLLHVP TLFARENGLD RKCRVKIRDE  360
QQRSWMFKLY VTAHNIFIGG IWHEFCSANF LKEGDRVMFE MFSKGEGLVL KFHDLRANAS  420
LQREQKKPNL DVKRVYTQGL RIEPSDVPAP KAQLPTPTSA NTNPHFIATI KSNTISRSVL  480
YLPMAFIKST GLMNRRKIIL TDEKQRSWPV QLTQRVDRFV ITKGFQKFMK ANGVQVGDTY  540
KFELIDDRTI HVVYFPCKYA VKDEKA*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc08g006200.1.1
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0092830.0Solanum lycopersicum genomic DNA, chromosome 8, clone: C08HBa0216M19, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025888234.10.0putative B3 domain-containing protein REM15 isoform X2
TrEMBLA0A3Q7HH920.0A0A3Q7HH92_SOLLC; Uncharacterized protein
STRINGSolyc08g006200.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32215171
Representative plantOGRP2682231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24680.28e-25B3 family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]