PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc08g006190.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family B3
Protein Properties Length: 545aa    MW: 62314.5 Da    PI: 9.4476
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc08g006190.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B343.84.7e-141193298
                        EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
                  B3  2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94
                        fk      ++k+g + +p  f+++ +    ++++  +  +s ++W+vk+  +++    +l +GW  F+k+n+L+ gD ++F+++g  +fe+ v
  Solyc08g006190.1.1 11 FKPI--LPNFKHG-IKIPVAFCKHLK---GCNQEHAILRKSDKKWQVKV--NGR----LLDEGWAIFAKENDLQLGDCLIFRHEG--DFEFEV 89
                        5666..5677777.9*******5553...45667888899*********..555....6***********************765..788899 PP

                        EEE- CS
                  B3 95 kvfr 98
                        ++f 
  Solyc08g006190.1.1 90 SIFG 93
                        9986 PP

2B335.51.7e-11157243596
                         -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
                  B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                         +++++ l++g + lp +fa+++++ +++  t+t++d + rs ++ l    ++ r+++++ W+eF+ an Lk gD +++  ++ ++ ++v++
  Solyc08g006190.1.1 157 TVTPYCLTRGHVQLPVQFARDNSLMNRR-CTITIRD-EQRSLTFAL--YSSGARTYIKGQWREFCIANCLKKGDQIMLAIVD-NGMNPVLR 242
                         5789999***************666544.4999999.6799*****..8899999**********************99766.55555665 PP

                         E CS
                  B3  96 v 96 
                         +
  Solyc08g006190.1.1 243 F 243
                         5 PP

3B355.11.4e-17303390698
                         ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
                  B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                         +++++  +++++lp +fa+ +g+  ++  +++l+de+ rsW+v+l  +  + r+ +tkGW++F +an++++gD+  F+l++ +++++v  +
  Solyc08g006190.1.1 303 IHPYAIIRALFYLPLSFARPNGLMRRC--KMILKDEKQRSWSVQL--EEVGPRFAITKGWRQFREANDVQVGDTYKFELIH-NGTTPVAYF 388
                         5778888999***********999766..7***************..99999***************************99.566677666 PP

                         E- CS
                  B3  97 fr 98 
                         +r
  Solyc08g006190.1.1 389 HR 390
                         65 PP

4B351.12.4e-16435514587
                         -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
                  B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                         +++++  +s  ++lp  fa+++++++++  +++l+de+ rsW+v l     + ++ +tkGW++F +ang ++gD+  F+l+++
  Solyc08g006190.1.1 435 TINPHCINSPFIYLPSAFAKSNSLVNRR-CKMILRDEKQRSWSVVL--APMGHHTAITKGWRQFREANGFQVGDTYKFELIDN 514
                         567888888889**********999766.59***************..999999*************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.8E-20395IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.69E-17495IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.18795IPR003340B3 DNA binding domain
CDDcd100171.19E-15892No hitNo description
SMARTSM010193.7E-111095IPR003340B3 DNA binding domain
PfamPF023625.1E-111593IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.107.0E-13150243IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.47E-14151243IPR015300DNA-binding pseudobarrel domain
CDDcd100172.19E-11152244No hitNo description
SMARTSM010191.6E-11153247IPR003340B3 DNA binding domain
PROSITE profilePS508639.446153246IPR003340B3 DNA binding domain
PfamPF023622.2E-10156243IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.109.6E-20292390IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.55E-19296390IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.465298391IPR003340B3 DNA binding domain
SMARTSM010196.1E-16299392IPR003340B3 DNA binding domain
CDDcd100176.31E-15299390No hitNo description
PfamPF023626.9E-16303390IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.7E-18426522IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.9E-18427523IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.957431525IPR003340B3 DNA binding domain
SMARTSM010197.8E-14432525IPR003340B3 DNA binding domain
CDDcd100172.01E-15432524No hitNo description
PfamPF023627.0E-15434514IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0009507Cellular Componentchloroplast
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 545 aa     Download sequence    Send to blast
MKFAPKKPHF FKPILPNFKH GIKIPVAFCK HLKGCNQEHA ILRKSDKKWQ VKVNGRLLDE  60
GWAIFAKEND LQLGDCLIFR HEGDFEFEVS IFGSNHFERV YEQTPKGGEE INHTCNKIIS  120
QAKTTEKTKL NVKSNEIIPE VEAAENMPLD RPPFIFTVTP YCLTRGHVQL PVQFARDNSL  180
MNRRCTITIR DEQRSLTFAL YSSGARTYIK GQWREFCIAN CLKKGDQIML AIVDNGMNPV  240
LRFYGNSDVI IFNLKLDLRT NASLQLEVKK PNLDAEEVSS RKEVATVPAS TSANANAQFV  300
SIIHPYAIIR ALFYLPLSFA RPNGLMRRCK MILKDEKQRS WSVQLEEVGP RFAITKGWRQ  360
FREANDVQVG DTYKFELIHN GTTPVAYFHR TRANASVQPE EKKPNLDARR VSARSNEADV  420
PASTCDNANT QFVSTINPHC INSPFIYLPS AFAKSNSLVN RRCKMILRDE KQRSWSVVLA  480
PMGHHTAITK GWRQFREANG FQVGDTYKFE LIDNGTIPIA YFHCEYIYFP SFHYVPPCYA  540
TLFQ*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc08g006190.1.1
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0092831e-167Solanum lycopersicum genomic DNA, chromosome 8, clone: C08HBa0216M19, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025888304.10.0B3 domain-containing protein REM17-like
TrEMBLA0A3Q7HH580.0A0A3Q7HH58_SOLLC; Uncharacterized protein
STRINGSolyc08g006190.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32215171
Representative plantOGRP2682231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24700.16e-50B3 family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]