PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc08g006110.2.1
Common NameLOC101259353
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 352aa    MW: 38858 Da    PI: 5.8049
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc08g006110.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1513.3e-16180236359
                         XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 
                         ++kr rr ++NRe+ArrsR+RK+a ++ Le  v+++ +eN+aL k+l   ++++++ 
  Solyc08g006110.2.1 180 DIKRIRRQASNRESARRSRRRKQAHLADLESQVDQFRGENEALFKQLADATQQYKES 236
                         58******************************************9988888887765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-15178242IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.6E-11180234No hitNo description
PROSITE profilePS5021711.024180235IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.62E-11181233No hitNo description
PfamPF001708.8E-14181238IPR004827Basic-leucine zipper domain
PROSITE patternPS000360185200IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MEKKMANFPS RDMKKSPSLL ALEEFVNHNK LFCGEDAKIG DVFGGNDHQQ NINNNNNINI  60
NINHHDHDNN NSHHHPQLFD DICSIAPSFT MSNQDILSGL SNCALTEKPL WSPNITPKQS  120
SISVTGDSQS SICAGSPTPT IIMSKMRDNQ TMGANSGSYS DDDDVEGDVG PCEESADPLD  180
IKRIRRQASN RESARRSRRR KQAHLADLES QVDQFRGENE ALFKQLADAT QQYKESLTNN  240
RVLKSNVEEL RAKVKLAEVR AARGTVSSSL SHLFLNYLTP PQSLDTNNNI TMRRLDNVSP  300
AINIIGEDSW GGISGQNPMI GVENVNAFDR NINNGAMSDN ASCISEVWSF K*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1194201RRSRRRKQ
2196201SRRRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.104310.0flower| fruit| stem
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in developing seeds from 10 to 30 days after flowering (DAF). {ECO:0000269|PubMed:11133985}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds to the DNA specific sequence 5'-TGAGTCA-3' found in seed storage protein gene promoters. {ECO:0000269|PubMed:11133985}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc08g006110.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0093571e-166Solanum lycopersicum genomic DNA, chromosome 8, clone: C08HBa0025I17, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004244469.10.0bZIP transcription factor RISBZ4
SwissprotQ6H5003e-57RSBZ4_ORYSJ; bZIP transcription factor RISBZ4
TrEMBLM1B6Y90.0M1B6Y9_SOLTU; Uncharacterized protein
STRINGSolyc08g006110.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA81392229
Representative plantOGRP69561017
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24800.18e-42basic leucine zipper 9
Publications ? help Back to Top
  1. Onodera Y,Suzuki A,Wu CY,Washida H,Takaiwa F
    A rice functional transcriptional activator, RISBZ1, responsible for endosperm-specific expression of storage protein genes through GCN4 motif.
    J. Biol. Chem., 2001. 276(17): p. 14139-52
    [PMID:11133985]
  2. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  3. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]