PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc08g005260.1.1
Common NameLOC101265660
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 362aa    MW: 40648 Da    PI: 7.8518
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc08g005260.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.23.2e-32177230255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Solyc08g005260.1.1 177 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 230
                         9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-15174230IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-28175230IPR009057Homeodomain-like
TIGRFAMsTIGR015578.3E-24177230IPR006447Myb domain, plants
PfamPF002496.1E-7178229IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MELFPPQPDL SLQISPPNTT TNQEENNIDL SFWERALESR KPHNININNT CCFDLSLSSN  60
IPRPSSILNH QDPKYPSSQY FQNNTNFINN PFIPHHHHNL GLFSPISGVP LYNNHQNSST  120
NNTLPIQSSP TSFNNYNNIN PISSSNSHFH QSHNHQNGLM RSRFFSRFPT KRSMRAPRMR  180
WTSTLHARFV HAVELLGGHE RATPKSVLEL MDVKDLTLAH VKSHLQMYRT VKTTDKSAVG  240
AASSGQSEVF DNVSSGDNSD DLLLEIKNSN KSELSVQQGR QNMYNQEKDY GGLWSNSSRE  300
SWHMHGKLGD YPGNLPSLEK NMEAKCTSYE GISTEVSSSS ITQASPKKPN LEFTLGIPNI  360
S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-17178232458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-17178232458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-17178232458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-17178232458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-17178232458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-17178232458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-17178232458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-17178232458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in developing phloem. {ECO:0000269|PubMed:14561401}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates lateral organ polarity. Promotes abaxial cell fate during lateral organd formation. Functions with KAN1 in the specification of polarity of the ovule outer integument. {ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:15286295, ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:17307928}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc08g005260.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0109390.0Solanum lycopersicum DNA, chromosome 8, clone: C08HBa0175O15, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004244407.20.0probable transcription factor KAN2 isoform X2
SwissprotQ9C6162e-69KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A3Q7HGR60.0A0A3Q7HGR6_SOLLC; Uncharacterized protein
STRINGSolyc08g005260.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27382255
Representative plantOGRP5701580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.12e-68G2-like family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]