PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc07g066330.2.1
Common NameLOC101261342
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 343aa    MW: 38826.6 Da    PI: 7.8311
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc07g066330.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.51.9e-51141431129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkk..leleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         lppGfrFhP+deel+++yL kkv++++   +    + evd++k+ePw++p+ +  + kewyf+s+rd+kyatg r+nrat sgyWkatgkd
  Solyc07g066330.2.1  14 LPPGFRFHPRDEELICDYLMKKVDQQSeyQQQYPLLIEVDLNKSEPWEIPEVACVGGKEWYFYSQRDRKYATGLRTNRATVSGYWKATGKD 104
                         79***********************996433334599*************7666789********************************** PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         +++++ kg+lvg++ktLvfy+grapkg+k+dWvmhe+rle
  Solyc07g066330.2.1 105 RAIIR-KGSLVGMRKTLVFYQGRAPKGRKSDWVMHEFRLE 143
                         ****9.999****************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-604165IPR003441NAC domain
PROSITE profilePS5100556.07414165IPR003441NAC domain
PfamPF023652.9E-2615142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MSNNNSLSMV ESKLPPGFRF HPRDEELICD YLMKKVDQQS EYQQQYPLLI EVDLNKSEPW  60
EIPEVACVGG KEWYFYSQRD RKYATGLRTN RATVSGYWKA TGKDRAIIRK GSLVGMRKTL  120
VFYQGRAPKG RKSDWVMHEF RLELPIRPQI SSIKEDWVLC RVFHKKKELL ATKQEIGSNN  180
IYYDNDTISC SSLPPLMDPY ITFDQTNPNN NNMNMNELYY EQVPCFSIFT PNQTFTSHSH  240
HLPSATTAIG STAYGGFPAD IGNYLNATAT SSTCDNNKVI RAVLSHLSTK NNIIMEGNNS  300
NNNNIINPAQ NIKGGNSPSF GEGSSETSFL SEVGYPTMWN NY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-5111664166NO APICAL MERISTEM PROTEIN
1ut4_B1e-5111664166NO APICAL MERISTEM PROTEIN
1ut7_A1e-5111664166NO APICAL MERISTEM PROTEIN
1ut7_B1e-5111664166NO APICAL MERISTEM PROTEIN
3swm_A1e-5111667169NAC domain-containing protein 19
3swm_B1e-5111667169NAC domain-containing protein 19
3swm_C1e-5111667169NAC domain-containing protein 19
3swm_D1e-5111667169NAC domain-containing protein 19
3swp_A1e-5111667169NAC domain-containing protein 19
3swp_B1e-5111667169NAC domain-containing protein 19
3swp_C1e-5111667169NAC domain-containing protein 19
3swp_D1e-5111667169NAC domain-containing protein 19
4dul_A1e-5111664166NAC domain-containing protein 19
4dul_B1e-5111664166NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.109760.0callus| flower| leaf
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Predominantly expressed in the root tip and in lateral root initiation sites. Also detected in expanding cotyledon, and in leaf primordia. {ECO:0000269|PubMed:11114891}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc07g066330.2.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by auxin.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1875390.0Solanum lycopersicum cv. Heinz 1706, chromosome 7 BAC clone C07HBa0179K09, complete sequence
GenBankAC2103610.0Solanum lycopersicum chromosome 7 clone C07HBa0215P04, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004243993.10.0NAC domain-containing protein 21/22 isoform X1
SwissprotQ84TE61e-108NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLA0A3Q7ID260.0A0A3Q7ID26_SOLLC; Uncharacterized protein
STRINGSolyc07g066330.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56010.21e-109NAC domain containing protein 1
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Le Hénanff G, et al.
    Grapevine NAC1 transcription factor as a convergent node in developmental processes, abiotic stresses, and necrotrophic/biotrophic pathogen tolerance.
    J. Exp. Bot., 2013. 64(16): p. 4877-93
    [PMID:24043850]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  5. Huo X,Wang C,Teng Y,Liu X
    Identification of miRNAs associated with dark-induced senescence in Arabidopsis.
    BMC Plant Biol., 2015. 15: p. 266
    [PMID:26530097]
  6. Chen X, et al.
    Auxin-Independent NAC Pathway Acts in Response to Explant-Specific Wounding and Promotes Root Tip Emergence during de Novo Root Organogenesis in Arabidopsis.
    Plant Physiol., 2016. 170(4): p. 2136-45
    [PMID:26850273]
  7. Liu C,Wang B,Li Z,Peng Z,Zhang J
    TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth.
    Plant Physiol., 2018. 176(1): p. 742-756
    [PMID:29122985]