PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc07g063420.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 330aa    MW: 37010.5 Da    PI: 8.6929
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc07g063420.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.99.7e-54161431128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeelvv+yLkk+v++ +l++ ++i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+
  Solyc07g063420.2.1  16 LPPGFRFHPTDEELVVHYLKKRVASVPLPV-SIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKP 105
                         79****************************.89***************988899************************************* PP

                 NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         vl++ ++++vg+kk Lvfy g+ pkg+kt+W+mheyrl
  Solyc07g063420.2.1 106 VLTAgGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRL 143
                         **9977788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-6510177IPR003441NAC domain
PROSITE profilePS5100562.50116176IPR003441NAC domain
PfamPF023654.4E-2817143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009753Biological Processresponse to jasmonic acid
GO:0045995Biological Processregulation of embryonic development
GO:0048317Biological Processseed morphogenesis
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MESTDSSTGS HHQPQLPPGF RFHPTDEELV VHYLKKRVAS VPLPVSIIAE VDLYKFDPWE  60
LPAKATFGEQ EWYFFSPRDR KYPNGARPNR AATSGYWKAT GTDKPVLTAG GTQKVGVKKA  120
LVFYGGKPPK GVKTNWIMHE YRLADNKTNN KPPGCDLANK KSLRLDDWVL CRIYKKNNTQ  180
RPIDHERDDL NIDMMMGSSS IHPSCIPNSM SMPNIFGQPK IPQLKSSNFG TTLIHDQNDQ  240
NLYEGGSQYS SKRPLANLYW NDQDGGASND NSQSTKRFLT ENMEDGLNMN ARADEQNGSI  300
VSLLSQQQVL GSLSEGVFRQ PYSGMNWYS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-7311796168NO APICAL MERISTEM PROTEIN
1ut4_B2e-7311796168NO APICAL MERISTEM PROTEIN
1ut7_A2e-7311796168NO APICAL MERISTEM PROTEIN
1ut7_B2e-7311796168NO APICAL MERISTEM PROTEIN
3swm_A2e-7311799171NAC domain-containing protein 19
3swm_B2e-7311799171NAC domain-containing protein 19
3swm_C2e-7311799171NAC domain-containing protein 19
3swm_D2e-7311799171NAC domain-containing protein 19
3swp_A2e-7311799171NAC domain-containing protein 19
3swp_B2e-7311799171NAC domain-containing protein 19
3swp_C2e-7311799171NAC domain-containing protein 19
3swp_D2e-7311799171NAC domain-containing protein 19
4dul_A2e-7311796168NAC domain-containing protein 19
4dul_B2e-7311796168NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.110490.0callus| flower| fruit
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed throughout anthers from stages 8 to 12. Later confined to distal region of anthers from stage 13. {ECO:0000269|PubMed:16055634}.
UniprotTISSUE SPECIFICITY: Stamen specific, in anthers from stage 8 (PubMed:15100403, PubMed:16055634). Expressed in the outer integument, but seems not expressed in the embryo at the torpedo stage (PubMed:18849494). {ECO:0000269|PubMed:15100403, ECO:0000269|PubMed:16055634, ECO:0000269|PubMed:18849494}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family (Probable). Together with NAC018/NARS2, regulates embryogenesis by regulating the development and degeneration of ovule integuments, a process required for intertissue communication between the embryo and the maternal integument (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00361DAPTransfer from AT3G15510Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc07g063420.2.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By Jasmonic acid (JA). {ECO:0000269|PubMed:16805732}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF7019870.0Solanum lycopersicum NAC3 mRNA, complete cds
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001266277.20.0NAC domain transcription factor
SwissprotQ9LD441e-109NAC56_ARATH; NAC transcription factor 56
TrEMBLK4CH250.0K4CH25_SOLLC; NAC transcription factor
STRINGSolyc07g063420.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18142466
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.11e-109NAC domain containing protein 2
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]