PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc07g062710.2.1
Common NameLOC101263229
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 303aa    MW: 33590.2 Da    PI: 5.9195
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc07g062710.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.91.6e-11182227550
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                         kr +r   NR +A+rsR RK+++i eLe+ v +L++e +aL  ++ 
  Solyc07g062710.2.1 182 KRIKRILANRQSAQRSRVRKLQYISELERSVTTLQTEVSALSPRVA 227
                         899**********************************999987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.5E-14178242IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.68180232IPR004827Basic-leucine zipper domain
PfamPF001703.9E-10182227IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.3E-14182233No hitNo description
SuperFamilySSF579591.13E-11182236No hitNo description
CDDcd147032.40E-24183233No hitNo description
PROSITE patternPS000360185200IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MAQLPPKVPT MAHNWPFQNM PPLPNSSTIV SNHHTTNSWV DDFLDFSSSR RNSHRRSVSD  60
PIAFVEAPFL QQCRGNGLSN GFDKLDDELL TTMFSDDSGA GAAFAGTAPC SNPSSTNPST  120
PSDQVSENED QKSPVRLEVN LVVQPKNEPG EDDSDNQSPV TSKNPVNDSS DNNNNNSIVD  180
PKRIKRILAN RQSAQRSRVR KLQYISELER SVTTLQTEVS ALSPRVAFLD HQRLLLNVDN  240
SALRQRIAAL AQDKIFKDAH QEALKKEIER LRQIYHEQNM KKMNTADEPP STAAPMSCTE  300
EA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.99350.0leaf| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO74126440.0
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator. {ECO:0000269|PubMed:17719007}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc07g062710.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004244256.10.0basic leucine zipper 61-like
SwissprotQ9M2K49e-89BZP61_ARATH; Basic leucine zipper 61
TrEMBLA0A3Q7IAY70.0A0A3Q7IAY7_SOLLC; Uncharacterized protein
STRINGSolyc07g062710.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17752465
Representative plantOGRP12617181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.18e-64bZIP family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Gibalov√° A, et al.
    Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.
    Plant Reprod, 2017. 30(1): p. 1-17
    [PMID:27896439]
  4. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]