PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc07g062240.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 214aa    MW: 24915.6 Da    PI: 9.3475
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc07g062240.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM78.41.7e-24191393128
                 NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                          GfrFhPtd el+ +yL + v +++l++   i+e d+y  +Pw +   +  +ek +y F++ +k ++ + r  r++ +g Wk++ + k+++
  Solyc07g062240.1.1  19 EGFRFHPTDRELM-KYLLHYVIDNPLPTLVPIEEEDLYLKDPWVFF-DA-RKEKTIYCFTELKKLKKGNLRFVRTVGDGSWKSQDRGKAII 106
                         7************.99*********999788**************6.33.357899********99999********************** PP

                 NAM  94 skkgelvglkktLvfy.kgrapkgektdWvmheyrl 128
                         s++g++ g k++L +  +g+++     +W+m+ey+l
  Solyc07g062240.1.1 107 SERGSVLGYKRSLRYQlRGSEH---DGQWLMKEYSL 139
                         ***************8344444...579******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.14E-2910167IPR003441NAC domain
PROSITE profilePS5100529.08517167IPR003441NAC domain
PfamPF023651.9E-1519139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MAQTMTYKPE CISYSAYTEG FRFHPTDREL MKYLLHYVID NPLPTLVPIE EEDLYLKDPW  60
VFFDARKEKT IYCFTELKKL KKGNLRFVRT VGDGSWKSQD RGKAIISERG SVLGYKRSLR  120
YQLRGSEHDG QWLMKEYSLS AEVKNQLRKQ LRENNKENYV LCRVKRKNGE YRKNEKDGPT  180
VQNEAIETEE LNAIISDPLN GVLKPVPTLN LAL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-142017318174Stress-induced transcription factor NAC1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc07g062240.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004244376.31e-158NAC domain-containing protein 83-like
TrEMBLM1AA791e-111M1AA79_SOLTU; Uncharacterized protein
STRINGSolyc07g062240.1.11e-158(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10241385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.17e-18NAC domain containing protein 32
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]